Ubiquitin-like protein ISG15 Recombinant Protein | ISG15 recombinant protein
Recombinant Human Ubiquitin-like protein ISG15
Gene Names
Isg15; G1p2; IP17; Irfp; UCRP; IGI15
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Ubiquitin-like protein ISG15; N/A; Recombinant Human Ubiquitin-like protein ISG15; Interferon-induced 15 kDa proteinInterferon-induced 17 kDa protein; IP17Ubiquitin cross-reactive protein; ISG15 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-157. Full length.
Sequence
GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG
Sequence Length
157
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for ISG15 recombinant protein
Ubiquitin-like protein which plays a key role in the innate immune response to viral infection either via its conjugation to a target protein (ISGylation) or via its action as a free or unconjugated protein. ISGylation involves a cascade of enzymatic reactions involving E1, E2, and E3 enzymes which catalyze the conjugation of ISG15 to a lysine residue in the target protein. Its target proteins include SERPINA3G/SPI2A, JAK1, MAPK3/ERK1, PLCG1, TRIM25, STAT5A, MAPK1/ERK2 and globin. Can also isgylate: DDX58/RIG-I which inhibits its function in antiviral signaling response and EIF4E2 which enhances its cap structure-binding activity and translation-inhibition activity. Exhibits antiviral activity towards both DNA and RNA viruses, including influenza A and B virus, sindbis virus (SV) and herpes simplex type-1 (HHV-1). Plays a significant role in the control of neonatal Chikungunya virus (CHIKV) infection by acting as a putative immunomodulator of proinflammatory cytokines. Protects mice against the consequences of Chikungunya virus infection by downregulating the pathogenic cytokine response, often denoted as the cytokine storm. Plays a role in erythroid differentiation. The secreted form of ISG15 can: induce natural killer cell proliferation, act as a chotactic factor for neutrophils and act as a IFN-gamma-inducing cytokine playing an essential role in antimycobacterial immunity
Product Categories/Family for ISG15 recombinant protein
References
Nucleotide sequence and deduced amino acid sequence of a cDNA encoding an interferon-induced mouse 15-KDa protein.Fahey D. Sequence differences between murine ISG15, human ISG15 and ubiquitin a functional divergence from ubiquitin.Garlie N.K., Haas A.L., D'Cunha J., Schilling D., Knight E. Jr., Borden E.C. Serpin 2a is induced in activated macrophages and conjugates to a ubiquitin homolog.Hamerman J.A., Hayashi F., Schroeder L.A., Gygi S.P., Haas A.L., Hampson L., Coughlin P., Aebersold R., Aderem A.J. Immunol. 168:2415-2423(2002) Identification of a ubiquitin family protein as a novel neutrophil chemotactic factor.Owhashi M., Taoka Y., Ishii K., Nakazawa S., Uemura H., Kambara H.Biochem. Biophys. Res. Commun. 309:533-539(2003) High-throughput immunoblotting. Ubiquitin-like protein ISG15 modifies key regulators of signal transduction.Malakhov M.P., Kim K.I., Malakhova O.A., Jacobs B.S., Borden E.C., Zhang D.-E.J. Biol. Chem. 278:16608-16613(2003) Identification of interferon-stimulated gene 15 as an antiviral molecule during Sindbis virus infection in vivo.Lenschow D.J., Giannakopoulos N.V., Gunn L.J., Johnston C., O'Guin A.K., Schmidt R.E., Levine B., Virgin H.W. IVJ. Virol. 79:13974-13983(2005) Negative regulation of ISG15 E3 ligase EFP through its autoISGylation.Zou W., Wang J., Zhang D.-E.Biochem. Biophys. Res. Commun. 354:321-327(2007) ISG15 modification of the eIF4E cognate 4EHP enhances cap structure-binding activity of 4EHP.Okumura F., Zou W., Zhang D.E.Genes Dev. 21:255-260(2007) IFN-stimulated gene 15 functions as a critical antiviral molecule against influenza, herpes, and Sindbis viruses.Lenschow D.J., Lai C., Frias-Staheli N., Giannakopoulos N.V., Lutz A., Wolff T., Osiak A., Levine B., Schmidt R.E., Garcia-Sastre A., Leib D.A., Pekosz A., Knobeloch K.P., Horak I., Virgin H.W. IVProc. Natl. Acad. Sci. U.S.A. 104:1371-1376(2007) Nitrosylation of ISG15 prevents the disulfide bond-mediated dimerization of ISG15 and contributes to effective ISGylation.Okumura F., Lenschow D.J., Zhang D.E.J. Biol. Chem. 283:24484-24488(2008) Negative feedback regulation of RIG-I-mediated antiviral signaling by interferon-induced ISG15 conjugation.Kim M.J., Hwang S.Y., Imaizumi T., Yoo J.Y.J. Virol. 82:1474-1483(2008) Emerging role of ISG15 in antiviral immunity.Skaug B., Chen Z.J.Cell 143:187-190(2010) ISG15 modulates development of the erythroid lineage.Maragno A.L., Pironin M., Alcalde H., Cong X., Knobeloch K.P., Tangy F., Zhang D.E., Ghysdael J., Quang C.T.PLoS ONE 6:E26068-E26068(2011) ISG15 is critical in the control of Chikungunya virus infection independent of UbE1L mediated conjugation.Werneke S.W., Schilte C., Rohatgi A., Monte K.J., Michault A., Arenzana-Seisdedos F., Vanlandingham D.L., Higgs S., Fontanet A., Albert M.L., Lenschow D.J.PLoS Pathog. 7:E1002322-E1002322(2011) Mycobacterial disease and impaired IFN-gamma immunity in humans with inherited ISG15 deficiency.Bogunovic D., Byun M., Durfee L.A., Abhyankar A., Sanal O., Mansouri D., Salem S., Radovanovic I., Grant A.V., Adimi P., Mansouri N., Okada S., Bryant V.L., Kong X.F., Kreins A., Velez M.M., Boisson B., Khalilzadeh S., Ozcelik U., Darazam I.A., Schoggins J.W., Rice C.M., Al-Muhsen S., Behr M., Vogt G., Puel A., Bustamante J., Gros P., Huibregtse J.M., Abel L., Boisson-Dupuis S., Casanova J.L.Science 337:1684-1688(2012)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
44.3 kDa
NCBI Official Full Name
ubiquitin-like protein ISG15
NCBI Official Synonym Full Names
ISG15 ubiquitin-like modifier
NCBI Official Symbol
Isg15
NCBI Official Synonym Symbols
G1p2; IP17; Irfp; UCRP; IGI15
NCBI Protein Information
ubiquitin-like protein ISG15
UniProt Protein Name
Ubiquitin-like protein ISG15
UniProt Gene Name
Isg15
UniProt Synonym Gene Names
G1p2; Ucrp; IP17
UniProt Entry Name
ISG15_MOUSE
Similar Products
Product Notes
The ISG15 isg15 (Catalog #AAA81637) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-157. Full length. The amino acid sequence is listed below: GWDLTVKMLA GNEFQVSLSS SMSVSELKAQ ITQKIGVHAF QQRLAVHPSG VALQDRVPLA SQGLGPGSTV LLVVDKCDEP LSILVRNNKG RSSTYEVRLT QTVAHLKQQV SGLEGVQDDL FWLTFEGKPL EDQLPLGEYG LKPLSTVFMN LRLRGG. It is sometimes possible for the material contained within the vial of "Ubiquitin-like protein ISG15, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
