ATP-sensitive inward rectifier potassium channel 1 (KCNJ1) Recombinant Protein | KCNJ1 recombinant protein
Recombinant Human ATP-sensitive inward rectifier potassium channel 1 (KCNJ1)
Gene Names
KCNJ1; ROMK; ROMK1; KIR1.1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
ATP-sensitive inward rectifier potassium channel 1 (KCNJ1); N/A; Recombinant Human ATP-sensitive inward rectifier potassium channel 1 (KCNJ1); Recombinant ATP-sensitive inward rectifier potassium channel 1 (KCNJ1); ATP-sensitive inward rectifier potassium channel 1; ATP-regulated potassium channel ROM-K Inward rectifier K(+) channel Kir1.1 Potassium channel, inwardly rectifying subfamily J membe; KCNJ1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
178-391aa; Cytoplasmic Domain
Sequence
ILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM
Sequence Length
391
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for KCNJ1 recombinant protein
In the kidney, probably plays a major role in potassium homeostasis. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. This channel is activated by internal ATP and can be blocked by external barium.
Product Categories/Family for KCNJ1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26.3 kDa
NCBI Official Full Name
ATP-sensitive inward rectifier potassium channel 1 isoform a
NCBI Official Synonym Full Names
potassium inwardly-rectifying channel, subfamily J, member 1
NCBI Official Symbol
KCNJ1
NCBI Official Synonym Symbols
ROMK; ROMK1; KIR1.1
NCBI Protein Information
ATP-sensitive inward rectifier potassium channel 1; inwardly rectifying K+ channel; inward rectifier K(+) channel Kir1.1; ATP-regulated potassium channel ROM-K; potassium channel, inwardly rectifying subfamily J member 1
UniProt Protein Name
ATP-sensitive inward rectifier potassium channel 1
UniProt Gene Name
KCNJ1
UniProt Synonym Gene Names
ROMK1
UniProt Entry Name
IRK1_HUMAN
Similar Products
Product Notes
The KCNJ1 kcnj1 (Catalog #AAA113974) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 178-391aa; Cytoplasmic Domain. The amino acid sequence is listed below: ILAKISRPKK RAKTITFSKN AVISKRGGKL CLLIRVANLR KSLLIGSHIY GKLLKTTVTP EGETIILDQI NINFVVDAGN ENLFFISPLT IYHVIDHNSP FFHMAAETLL QQDFELVVFL DGTVESTSAT CQVRTSYVPE EVLWGYRFAP IVSKTKEGKY RVDFHNFSKT VEVETPHCAM CLYNEKDVRA RMKRGYDNPN FILSEVNETD DTKM. It is sometimes possible for the material contained within the vial of "ATP-sensitive inward rectifier potassium channel 1 (KCNJ1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
