Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113418_SDS_PAGE15.jpg SDS-PAGE

Kinesin-like protein KIF1A Recombinant Protein | Kif1a recombinant protein

Recombinant Mouse Kinesin-like protein KIF1A

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Kinesin-like protein KIF1A; N/A; Recombinant Mouse Kinesin-like protein KIF1A; Axonal transporter of synaptic vesicles; Kif1a recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-361aa; Partial
Sequence
MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAIIN
Sequence Length
1,695
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

product-image-AAA113418_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for Kif1a recombinant protein
Motor for anterograde axonal transport of synaptic vesicle precursors.
References
The neuron-specific kinesin superfamily protein KIF1A is a unique monomeric motor for anterograde axonal transport of synaptic vesicle precursors.Okada Y., Yamazaki H., Sekine-Aizawa Y., Hirokawa N.Cell 81:769-780(1995) Kinesin family in murine central nervous system.Aizawa H., Sekine Y., Takemura R., Zhang Z., Nangaku M., Hirokawa N.J. Cell Biol. 119:1287-1296(1992) Switch-based mechanism of kinesin motors.Kikkawa M., Sablin E.P., Okada Y., Yajima H., Fletterick R.J., Hirokawa N.Nature 411:439-445(2001) KIF1A alternately uses two loops to bind microtubules.Nitta R., Kikkawa M., Okada Y., Hirokawa N.Science 305:678-683(2004) Structural model for strain-dependent microtubule activation of Mg-ADP release from kinesin.Nitta R., Okada Y., Hirokawa N.Nat. Struct. Mol. Biol. 15:1067-1075(2008)

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
56.4 kDa
NCBI Official Full Name
Kinesin-like protein KIF1A
UniProt Protein Name
Kinesin-like protein KIF1A
UniProt Gene Name
Kif1a
UniProt Synonym Gene Names
Atsv; Kif1
UniProt Entry Name
KIF1A_MOUSE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Kif1a kif1a (Catalog #AAA113418) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-361aa; Partial. The amino acid sequence is listed below: MAGASVKVAV RVRPFNSREM SRDSKCIIQM SGSTTTIVNP KQPKETPKSF SFDYSYWSHT SPEDINYASQ KQVYRDIGEE MLQHAFEGYN VCIFAYGQTG AGKSYTMMGK QEKDQQGIIP QLCEDLFSRI NDTTNDNMSY SVEVSYMEIY CERVRDLLNP KNKGNLRVRE HPLLGPYVED LSKLAVTSYN DIQDLMDSGN KPRTVAATNM NETSSRSHAV FNIIFTQKRH DAETNITTEK VSKISLVDLA GSERADSTGA KGTRLKEGAN INKSLTTLGK VISALAEMDS GPNKNKKKKK TDFIPYRDSV LTWLLRENLG GNSRTAMVAA LSPADINYDE TLSTLRYADR AKQIRCNAII N. It is sometimes possible for the material contained within the vial of "Kinesin-like protein KIF1A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.