NKG2-D type II integral membrane protein (KLRK1) Recombinant Protein | KLRK1 recombinant protein
Recombinant Pig NKG2-D type II integral membrane protein (KLRK1), partial
Gene Names
KLRK1; NKG2D
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
NKG2-D type II integral membrane protein (KLRK1); N/A; Recombinant Pig NKG2-D type II integral membrane protein (KLRK1), partial; KLRK1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
78-214aa; partial;
Sequence
NLLFNQEAPSPLKESYCGPCPKNWICYRNSCYQFSNESKTWLQSQASCRSQNSSLLKIYSREDQDFFKLVKSYHWMGLVQIPTNRSWQWEDGSILSPNQITMVEMQNGSCAVYGSSFKGYTENCLTLNTYICMKRTV
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for KLRK1 recombinant protein
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. This gene encodes a member of the NKG2 family, and the encoded transmembrane protein is characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
9,234 Da
NCBI Official Full Name
NKG2-D type II integral membrane protein
NCBI Official Symbol
KLRK1
NCBI Official Synonym Symbols
NKG2D
NCBI Protein Information
NKG2-D type II integral membrane protein
UniProt Protein Name
NKG2-D type II integral membrane protein
UniProt Gene Name
KLRK1
UniProt Synonym Gene Names
NKG2D
Similar Products
Product Notes
The KLRK1 klrk1 (Catalog #AAA117442) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 78-214aa; partial;. The amino acid sequence is listed below: NLLFNQEAPS PLKESYCGPC PKNWICYRNS CYQFSNESKT WLQSQASCRS QNSSLLKIYS REDQDFFKLV KSYHWMGLVQ IPTNRSWQWE DGSILSPNQI TMVEMQNGSC AVYGSSFKGY TENCLTLNTY ICMKRTV. It is sometimes possible for the material contained within the vial of "NKG2-D type II integral membrane protein (KLRK1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.