Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283391_AD13.jpg Application Data (The purity of Mouse NKG2D is greater than 95% as determined by SEC-HPLC.)

NKG2-D/KLRK1/CD314 Recombinant Protein | NKG2D/CD314 recombinant protein

Recombinant Mouse NKG2-D/KLRK1/CD314 Protein

Purity
>95% as determined by Tris-Bis PAGE; >95% as determined by HPLC
Synonyms
NKG2-D/KLRK1/CD314; N/A; Recombinant Mouse NKG2-D/KLRK1/CD314 Protein; CD314; D12S2489E; KLR; NKG2-D; NKG2D; NKG2D/CD314 recombinant protein
Ordering
Host
HEK293 cells
Purity/Purification
>95% as determined by Tris-Bis PAGE; >95% as determined by HPLC
Sequence
FKETFQPVLCNKEVPVSSREGYCGPCPNNWICHRNNCYQFFNEEKTWNQSQASCLSQNSSLLKIYSKEEQDFLKLVKSYHWMGLVQIPANGSWQWEDGSSLSYNQLTLVEIPKGSCAVYGSSFKAYTEDCANLNTYICMKRAV
Species
Mouse
Tag
N-hFc
Endotoxin
<0.1EU/ug by the LAL method.
Preparation and Storage
Store at -20 degree C. Store the lyophilized protein at -20 degree C to -80 degree C up to 1 year from the date of receipt.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

Application Data

(The purity of Mouse NKG2D is greater than 95% as determined by SEC-HPLC.)

product-image-AAA283391_AD13.jpg Application Data (The purity of Mouse NKG2D is greater than 95% as determined by SEC-HPLC.)

SDS-PAGE

(Recombinant Mouse NKG2D/CD314 Protein was resolved with SDS PAGE under reducing (R) and non-reducing (NR) conditions ?showing single bands at 50-60 kDa and 100-140 kDa, respectively.)

product-image-AAA283391_SDS_PAGE15.jpg SDS-PAGE (Recombinant Mouse NKG2D/CD314 Protein was resolved with SDS PAGE under reducing (R) and non-reducing (NR) conditions ?showing single bands at 50-60 kDa and 100-140 kDa, respectively.)
Related Product Information for NKG2D/CD314 recombinant protein
NKG2D is a type II transmembrane glycoprotein having an extracellular lectin-like domain. This domain lacks the recognizable calcium-binding sites found in true C-type lectins and binds protein rather than carbohydrate ligands. Human NKG2D is expressed on CD8 alpha beta T cells, gamma delta T cells, NK cells and NKT cells.
Product Categories/Family for NKG2D/CD314 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
UniProt Protein Name
NKG2-D type II integral membrane protein
UniProt Gene Name
Klrk1
UniProt Synonym Gene Names
Nkg2d
UniProt Entry Name
NKG2D_MOUSE

Similar Products

Product Notes

The NKG2D/CD314 klrk1 (Catalog #AAA283391) is a Recombinant Protein produced from HEK293 cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: FKETFQPVLC NKEVPVSSRE GYCGPCPNNW ICHRNNCYQF FNEEKTWNQS QASCLSQNSS LLKIYSKEEQ DFLKLVKSYH WMGLVQIPAN GSWQWEDGSS LSYNQLTLVE IPKGSCAVYG SSFKAYTEDC ANLNTYICMK RAV. It is sometimes possible for the material contained within the vial of "NKG2-D/KLRK1/CD314, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.