SDS-PAGE
Importin subunit alpha-1 (KPNA1) Recombinant Protein | KPNA1 recombinant protein
Recombinant Human Importin subunit alpha-1 (KPNA1), partial
Gene Names
KPNA1; RCH2; SRP1; IPOA5; NPI-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Importin subunit alpha-1 (KPNA1); N/A; Recombinant Human Importin subunit alpha-1 (KPNA1), partial; KPNA1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
8-538aa; Partial
Sequence
NFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for KPNA1 recombinant protein
Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus.
References
Identification of hSRP1 alpha as a functional receptor for nuclear localization sequences.Weis K., Mattaj I.W., Lamond A.I.Science 268:1049-1053(1995)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
63.5 kDa
NCBI Official Full Name
importin subunit alpha-5
NCBI Official Synonym Full Names
karyopherin subunit alpha 1
NCBI Official Symbol
KPNA1
NCBI Official Synonym Symbols
RCH2; SRP1; IPOA5; NPI-1
NCBI Protein Information
importin subunit alpha-5
UniProt Protein Name
Importin subunit alpha-5
UniProt Gene Name
KPNA1
UniProt Synonym Gene Names
RCH2; NPI-1
Similar Products
Product Notes
The KPNA1 kpna1 (Catalog #AAA233504) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 8-538aa; Partial. The amino acid sequence is listed below: NFRLKSYKNK SLNPDEMRRR REEEGLQLRK QKREEQLFKR RNVATAEEET EEEVMSDGGF HEAQISNMEM APGGVITSDM IEMIFSKSPE QQLSATQKFR KLLSKEPNPP IDEVISTPGV VARFVEFLKR KENCTLQFES AWVLTNIASG NSLQTRIVIQ AGAVPIFIEL LSSEFEDVQE QAVWALGNIA GDSTMCRDYV LDCNILPPLL QLFSKQNRLT MTRNAVWALS NLCRGKSPPP EFAKVSPCLN VLSWLLFVSD TDVLADACWA LSYLSDGPND KIQAVIDAGV CRRLVELLMH NDYKVVSPAL RAVGNIVTGD DIQTQVILNC SALQSLLHLL SSPKESIKKE ACWTISNITA GNRAQIQTVI DANIFPALIS ILQTAEFRTR KEAAWAITNA TSGGSAEQIK YLVELGCIKP LCDLLTVMDS KIVQVALNGL ENILRLGEQE AKRNGTGINP YCALIEEAYG LDKIEFLQSH ENQEIYQKAF DLIEHYFGTE DEDSSIAPQV DLNQQQYIFQ QCEAPMEGFQ L. It is sometimes possible for the material contained within the vial of "Importin subunit alpha-1 (KPNA1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.