Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA113748_SDS_PAGE15.jpg SDS-PAGE

Lactadherin Recombinant Protein | MFGE8 recombinant protein

Recombinant human Lactadherin protein

Average rating 0.0
No ratings yet
Gene Names
MFGE8; BA46; HMFG; MFGM; SED1; hP47; EDIL1; MFG-E8; SPAG10; OAcGD3S; HsT19888
Applications
ELISA, SDS-Page
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lactadherin; N/A; Recombinant human Lactadherin protein; Breast epithelial antigen BA46 HMFG MFGM Milk fat globule-EGF factor 8; MFG-E8; MFGE8 recombinant protein
Ordering
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC
Applicable Applications for MFGE8 recombinant protein
ELISA, SDS-PAGE
Preparation and Storage
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C. Notes ? Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

product-image-AAA113748_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for MFGE8 recombinant protein
Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization .Contributes to phagocytic removal of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction. Binds specifically to rotavirus and inhibits its replication.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
55KD
NCBI Official Full Name
lactadherin isoform a preproprotein
NCBI Official Synonym Full Names
milk fat globule-EGF factor 8 protein
NCBI Official Symbol
MFGE8
NCBI Official Synonym Symbols
BA46; HMFG; MFGM; SED1; hP47; EDIL1; MFG-E8; SPAG10; OAcGD3S; HsT19888
NCBI Protein Information
lactadherin

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MFGE8 (Catalog #AAA113748) is a Recombinant Protein and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Lactadherin can be used in a range of immunoassay formats including, but not limited to, ELISA, SDS-PAGE. Researchers should empirically determine the suitability of the MFGE8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LDICSKNPCH NGGLCEEISQ EVRGDVFPSY TCTCLKGYAG NHCETKCVEP LGMENGNIAN SQIAASSVRV TFLGLQHWVP ELARLNRAGM VNAWTPSSND DNPWIQVNLL RRMWVTGVVT QGASRLASHE YLKAFKVAYS LNGHEFDFIH DVNKKHKEFV GNWNKNAVHV NLFETPVEAQ YVRLYPTSCH TACTLRFELL GCELNGCANP LGLKNNSIPD KQITASSSYK TWGLHLFSWN PSYARLDKQG NFNAWVAGSY GNDQWLQVDL GSSKEVTGII TQGARNFGSV QFVASYKVAY SNDSANWTEY QDPRTGSSKI FPGNWDNHSH KKNLFETPIL ARYVRILPVA WHNRIALRLE LLGC. It is sometimes possible for the material contained within the vial of "Lactadherin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.