Protease lasA (lasA) Recombinant Protein | lasA recombinant protein
Recombinant Pseudomonas aeruginosa Protease lasA (lasA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protease lasA (lasA); N/A; Recombinant Pseudomonas aeruginosa Protease lasA (lasA); Protease lasA; EC=3.4.24.-; Staphylolytic protease; lasA recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
237-418aa; partial
Sequence
APPSNLMQLPWRQGYSWQPNGAHSNTGSGYPYSSFDASYDWPRWGSATYSVVAAHAGTVRVLSRCQVRVTHPSGWATNYYHMDQIQVSNGQQVSADTKLGVYAGNINTALCEGGSSTGPHLHFSLLYNGAFVSLQGASFGPYRINVGTSNYDNDCRRYYFYNQSAGTTHCAFRPLYNPGLAL
Species
Pseudomonas aeruginosa (strain 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for lasA recombinant protein
Involved in proteolysis and elastolysis (degradation of the host protein elastin). Has staphylolytic activity (degrades pentaglycine cross-links in cell wall peptidogylcan), preferring Gly-Gly-|-X substrates where X is Ala or Gly (PubMed:11179971). Enhances the elastolytic but not proteolytic activity of elastase (lasB) and elastolytic activity of other proteases (PubMed:2110137). Degradation of host elastin is likely to contribute to the pathogenicity of P.aeruginosa. While either His-317 or His-356 can abstract a proton in the hydrolysis reaction, the same residue performs both functions in a given catalytic cycle, with the other stabilizing the catalytic intermediate (PubMed:20026068).
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36 kDa
NCBI Official Full Name
LasA protease
NCBI Official Symbol
lasA
NCBI Protein Information
LasA protease
UniProt Protein Name
Protease LasA
UniProt Gene Name
lasA
UniProt Synonym Gene Names
PA1871
UniProt Entry Name
LASA_PSEAE
Similar Products
Product Notes
The lasA lasa (Catalog #AAA18662) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 237-418aa; partial. The amino acid sequence is listed below: APPSNLMQLP WRQGYSWQPN GAHSNTGSGY PYSSFDASYD WPRWGSATYS VVAAHAGTVR VLSRCQVRVT HPSGWATNYY HMDQIQVSNG QQVSADTKLG VYAGNINTAL CEGGSSTGPH LHFSLLYNGA FVSLQGASFG PYRINVGTSN YDNDCRRYYF YNQSAGTTHC AFRPLYNPGL AL . It is sometimes possible for the material contained within the vial of "Protease lasA (lasA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
