Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA55956_SDS_PAGE15.jpg SDS-PAGE

NGAL recombinant protein

Recombinant Human NGAL Protein

Gene Names
LCN2; p25; 24p3; MSFI; NGAL
Applications
ELISA, Western Blot
Purity
> 90 % as determined by SDS-PAGE.
Synonyms
NGAL; N/A; Recombinant Human NGAL Protein; LCN2; p25; Lipocalin 2; Oncogene 24p3; 25 kDa alpha-2-microglobulin-related subunit of MMP-9; Siderocalin LCN2.; NGAL recombinant protein
Ordering
Host
E. coli
Purity/Purification
> 90 % as determined by SDS-PAGE.
Form/Format
0.15 M PBS, pH 7.5, with 50% glycerol.
Concentration
1 mg/mL (varies by lot)
Sequence Positions
3-198
Sequence
QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
Sequence Length
198
Applicable Applications for NGAL recombinant protein
ELISA, WB (Western Blot)
Source
Human
Protein Residues
with N-terminal 6×His-tag.
Endotoxin Level
Please contact us for more information.
Preparation and Storage
Storage: Store it under sterile conditions at -20°C upon receiving. Recommend to aliquot the protein into smaller quantities for optimal storage.
**Avoid repeated freeze-thaw cycles.**

Stability: The recombinant protein is stable for up to 6 months from date of receipt at -80°C.

SDS-PAGE

product-image-AAA55956_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for NGAL recombinant protein
NGAL (neutrophil gelatinase-associated lipocalin) belongs to the lipocalin family of proteins. These are typically small secreted proteins characterized by their ability to bind small, hydrophobic molecules in a structurally conserved pocket formed by beta-pleated sheet, to bind to specific cell-surface receptors and to form macromolecular complexes. NGAL has many synonyms: it also known as NL (neutrophil lipocalin,HNL, rat NL), lipocalin, oncogene protein 24p3 or uterocalin (in the mouse) and neu-related lipocalin or 25 kDa alpha 2-microglobulin-related protein6 (in the rat). Rat NGAL consists of a single disulfide-bridged polypeptide chain of 178 amino-acid residues with a calculated molecular mass of 22 kDa, but glycosylation increases its apparent molecular mass to 25 kDa.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22 kDa
NCBI Official Full Name
neutrophil gelatinase-associated lipocalin
NCBI Official Synonym Full Names
lipocalin 2
NCBI Official Symbol
LCN2
NCBI Official Synonym Symbols
p25; 24p3; MSFI; NGAL
NCBI Protein Information
neutrophil gelatinase-associated lipocalin
UniProt Protein Name
Neutrophil gelatinase-associated lipocalin
UniProt Gene Name
LCN2
UniProt Synonym Gene Names
HNL; NGAL; NGAL
UniProt Entry Name
NGAL_HUMAN

Similar Products

Product Notes

The NGAL lcn2 (Catalog #AAA55956) is a Recombinant Protein produced from E. coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 3-198. AAA Biotech's NGAL can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the NGAL lcn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QDSTSDLIPA PPLSKVPLQQ NFQDNQFQGK WYVVGLAGNA ILREDKDPQK MYATIYELKE DKSYNVTSVL FRKKKCDYWI RTFVPGCQPG EFTLGNIKSY PGLTSYLVRV VSTNYNQHAM VFFKKVSQNR EYFKITLYGR TKELTSELKE NFIRFSKSLG LPENHIVFPV PIDQCIDG. It is sometimes possible for the material contained within the vial of "NGAL, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.