Epididymal-specific lipocalin-5 (Lcn5) Recombinant Protein | Lcn5 recombinant protein
Recombinant Mouse Epididymal-specific lipocalin-5 (Lcn5)
Gene Names
Lcn5; Erabp; MEP10; E-RABP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Epididymal-specific lipocalin-5 (Lcn5); N/A; Recombinant Mouse Epididymal-specific lipocalin-5 (Lcn5); Epididymal-specific lipocalin-5; Epididymal retinoic acid-binding protein; E-RABP; mE-RABP; Epididymal secretory protein 10; MEP 10Cleaved into the following 2 chains:; 1. Epididymal-specific lipocalin-5, major form; 2. Epididymal-specific lipocalin-5, mi; Lcn5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
27-192aa; Full Length of Mature Protein
Sequence
TEAAVVKDFDVNKFLGFWYEIALASKMGAYGLAHKEEKMGAMVVELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRISGEKEVVVVATDYMTYTVIDITSLVAGAVHRAMKLYSRSLDNNGEALNNFQKIALKHGFSETDIHILKHDLTCVNALQSGQI
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Lcn5 recombinant protein
Associates with spermatozoa in the epididymal fluid but does not bind tightly to them. Binds both all-trans and 13-cis retinoic acid. May act as a retinoid carrier protein which is required for epididymal function and/or sperm maturation.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
22.3 kDa
NCBI Official Full Name
epididymal-specific lipocalin-5 isoform b
NCBI Official Synonym Full Names
lipocalin 5
NCBI Official Symbol
Lcn5
NCBI Official Synonym Symbols
Erabp; MEP10; E-RABP
NCBI Protein Information
epididymal-specific lipocalin-5; epididymal secretory protein 10; epididymal retinoic acid binding protein
UniProt Protein Name
Epididymal-specific lipocalin-5
UniProt Gene Name
Lcn5
UniProt Synonym Gene Names
E-RABP; mE-RABP; MEP 10
UniProt Entry Name
LCN5_MOUSE
Similar Products
Product Notes
The Lcn5 lcn5 (Catalog #AAA114370) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 27-192aa; Full Length of Mature Protein. The amino acid sequence is listed below: TEAAVVKDFD VNKFLGFWYE IALASKMGAY GLAHKEEKMG AMVVELKENL LALTTTYYNE GHCVLEKVAA TQVDGSAKYK VTRISGEKEV VVVATDYMTY TVIDITSLVA GAVHRAMKLY SRSLDNNGEA LNNFQKIALK HGFSETDIHI LKHDLTCVNA LQSGQI. It is sometimes possible for the material contained within the vial of "Epididymal-specific lipocalin-5 (Lcn5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
