L-lactate dehydrogenase C chain Recombinant Protein | LDHC recombinant protein
Recombinant Human L-lactate dehydrogenase C chain
Gene Names
LDHC; CT32; LDH3; LDHX
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
L-lactate dehydrogenase C chain; N/A; Recombinant Human L-lactate dehydrogenase C chain; Cancer/testis antigen 32; CT32; LDH testis subunit; LDH-X; LDHC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-332. Partial
Sequence
STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for LDHC recombinant protein
Possible role in sperm motility. (S)-lactate + NAD+ = pyruvate + NADH.
Product Categories/Family for LDHC recombinant protein
References
"Epitopes of human testis-specific lactate dehydrogenase deduced from a cDNA sequence." Millan J.L., Driscoll C.E., Goldberg E. Proc. Natl. Acad. Sci. U.S.A. 84:5311-5315(1987)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38.2 kDa
NCBI Official Full Name
L-lactate dehydrogenase C chain
NCBI Official Synonym Full Names
lactate dehydrogenase C
NCBI Official Symbol
LDHC
NCBI Official Synonym Symbols
CT32; LDH3; LDHX
NCBI Protein Information
L-lactate dehydrogenase C chain
UniProt Protein Name
L-lactate dehydrogenase C chain
UniProt Gene Name
LDHC
UniProt Synonym Gene Names
LDH3; LDHX; LDH-C; CT32
UniProt Entry Name
LDHC_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The LDHC ldhc (Catalog #AAA113362) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-332. Partial. The amino acid sequence is listed below: STVKEQLIEK LIEDDENSQC KITIVGTGAV GMACAISILL KDLADELALV DVALDKLKGE MMDLQHGSLF FSTSKITSGK DYSVSANSRI VIVTAGARQQ EGETRLALVQ RNVAIMKSII PAIVHYSPDC KILVVSNPVD ILTYIVWKIS GLPVTRVIGS GCNLDSARFR YLIGEKLGVH PTSCHGWIIG EHGDSSVPLW SGVNVAGVAL KTLDPKLGTD SDKEHWKNIH KQVIQSAYEI IKLKGYTSWA IGLSVMDLVG SILKNLRRVH PVSTMVKGLY GIKEELFLSI PCVLGRNGVS DVVKINLNSE EEALFKKSAE TLWNIQKDLI F. It is sometimes possible for the material contained within the vial of "L-lactate dehydrogenase C chain, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
