Leukocyte immunoglobulin-like receptor subfamily B member 2 (LILRB2) Recombinant Protein | LILRB2 recombinant protein
Recombinant Human Leukocyte immunoglobulin-like receptor subfamily B member 2 (LILRB2), partial
Gene Names
LILRB2; ILT4; LIR2; CD85D; ILT-4; LIR-2; MIR10; MIR-10
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Leukocyte immunoglobulin-like receptor subfamily B member 2 (LILRB2); N/A; Recombinant Human Leukocyte immunoglobulin-like receptor subfamily B member 2 (LILRB2), partial; LILRB2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-460 aa; Extracellular
Sequence
QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPGPEDQPLTPTGSDPQSGLGRHLGV
Species
Human
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for LILRB2 recombinant protein
This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
51,959 Da
NCBI Official Full Name
Leukocyte immunoglobulin-like receptor subfamily B member 2
NCBI Official Synonym Full Names
leukocyte immunoglobulin like receptor B2
NCBI Official Symbol
LILRB2
NCBI Official Synonym Symbols
ILT4; LIR2; CD85D; ILT-4; LIR-2; MIR10; MIR-10
NCBI Protein Information
leukocyte immunoglobulin-like receptor subfamily B member 2
UniProt Protein Name
Leukocyte immunoglobulin-like receptor subfamily B member 2
UniProt Gene Name
LILRB2
UniProt Synonym Gene Names
ILT4; LIR2; MIR10; LIR-2; Leukocyte immunoglobulin-like receptor 2; ILT-4; MIR-10
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The LILRB2 lilrb2 (Catalog #AAA116834) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-460 aa; Extracellular. The amino acid sequence is listed below: QTGTIPKPTL WAEPDSVITQ GSPVTLSCQG SLEAQEYRLY REKKSASWIT RIRPELVKNG QFHIPSITWE HTGRYGCQYY SRARWSELSD PLVLVMTGAY PKPTLSAQPS PVVTSGGRVT LQCESQVAFG GFILCKEGED EHPQCLNSQP HARGSSRAIF SVGPVSPNRR WSHRCYGYDL NSPYVWSSPS DLLELLVPGV SKKPSLSVQP GPVMAPGESL TLQCVSDVGY DRFVLYKEGE RDLRQLPGRQ PQAGLSQANF TLGPVSRSYG GQYRCYGAHN LSSECSAPSD PLDILITGQI RGTPFISVQP GPTVASGENV TLLCQSWRQF HTFLLTKAGA ADAPLRLRSI HEYPKYQAEF PMSPVTSAHA GTYRCYGSLN SDPYLLSHPS EPLELVVSGP SMGSSPPPTG PISTPGPEDQ PLTPTGSDPQ SGLGRHLGV. It is sometimes possible for the material contained within the vial of "Leukocyte immunoglobulin-like receptor subfamily B member 2 (LILRB2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.