Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281516_SDS_PAGE15.jpg SDS-PAGE (Recombinant Human LILRB2/CD85d/ILT4 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 70-85 kDa.)

LILRB2/CD85d/ILT4 Recombinant Protein | LILRB2 recombinant protein

Recombinant Human LILRB2/CD85d/ILT4 Protein

Gene Names
LILRB2; ILT4; LIR2; CD85D; ILT-4; LIR-2; MIR10; MIR-10
Purity
>95% by SDS-PAGE.
Synonyms
LILRB2/CD85d/ILT4; N/A; Recombinant Human LILRB2/CD85d/ILT4 Protein; CD85D; ILT-4; ILT4; LIR-2; LIR2; MIR-10; MIR10; LILRB2 recombinant protein
Ordering
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHLGV
Sequence Length
598
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-PAGE

(Recombinant Human LILRB2/CD85d/ILT4 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 70-85 kDa.)

product-image-AAA281516_SDS_PAGE15.jpg SDS-PAGE (Recombinant Human LILRB2/CD85d/ILT4 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 70-85 kDa.)
Related Product Information for LILRB2 recombinant protein
Recombinant Human LILRB2/CD85d/ILT4 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln 22 - Val 461) of human LILRB2/CD85d/ILT4 (Accession #AAB87662) fused with a 6xHis tag at the C-terminus.
Product Categories/Family for LILRB2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
leukocyte immunoglobulin-like receptor subfamily B member 2 isoform 1
NCBI Official Synonym Full Names
leukocyte immunoglobulin like receptor B2
NCBI Official Symbol
LILRB2
NCBI Official Synonym Symbols
ILT4; LIR2; CD85D; ILT-4; LIR-2; MIR10; MIR-10
NCBI Protein Information
leukocyte immunoglobulin-like receptor subfamily B member 2
UniProt Protein Name
Leukocyte immunoglobulin-like receptor subfamily B member 2
UniProt Gene Name
LILRB2
UniProt Synonym Gene Names
ILT4; LIR2; MIR10; LIR-2; Leukocyte immunoglobulin-like receptor 2; ILT-4; MIR-10
UniProt Entry Name
LIRB2_HUMAN

Similar Products

Product Notes

The LILRB2 lilrb2 (Catalog #AAA281516) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: QTGTIPKPTL WAEPDSVITQ GSPVTLSCQG SLEAQEYRLY REKKSASWIT RIRPELVKNG QFHIPSITWE HTGRYGCQYY SRARWSELSD PLVLVMTGAY PKPTLSAQPS PVVTSGGRVT LQCESQVAFG GFILCKEGED EHPQCLNSQP HARGSSRAIF SVGPVSPNRR WSHRCYGYDL NSPYVWSSPS DLLELLVPGV SKKPSLSVQP GPVVAPGESL TLQCVSDVGY DRFVLYKEGE RDLRQLPGRQ PQAGLSQANF TLGPVSRSYG GQYRCYGAYN LSSEWSAPSD PLDILITGQI HGTPFISVQP GPTVASGENV TLLCQSWRQF HTFLLTKAGA ADAPLRLRSI HEYPKYQAEF PMSPVTSAHA GTYRCYGSLN SDPYLLSHPS EPLELVVSGP SMGSSPPPTG PISTPAGPED QPLTPTGSDP QSGLGRHLGV. It is sometimes possible for the material contained within the vial of "LILRB2/CD85d/ILT4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.