General odorant-binding protein lush (lush) Recombinant Protein | lush recombinant protein
Recombinant Drosophila melanogaster General odorant-binding protein lush (lush)
Gene Names
lush; 76a; 76c; 76c(LUSH); CG8807; DmelObp76a; DmelCG8807; Lush; LUSH; obp76a; Obp76a
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
General odorant-binding protein lush (lush); N/A; Recombinant Drosophila melanogaster General odorant-binding protein lush (lush); General odorant-binding protein lush; lush recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
30-153aa; Full Length of Mature Protein
Sequence
MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP
Sequence Length
153
Species
Drosophila melanogaster (Fruit fly)
Production Note
Special Offer: The E. coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E. coli host-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E. coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E. coli host-expressed protein for the fastest delivery among all hosts. Please or email to for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for lush recombinant protein
Odorant-binding protein required for olfactory behavior and for activity of pheromone-sensitive neurons. Binds to alcohols and mediates avoidance behavior to high concentrations of alcohols, the alcohol-binding possibly resulting in activation of receptors on T2B neurons, the activation of these receptors inhibiting these neurons. Acts in concert with Snmp and lush to capture cVA molecules on the surface of Or67d expressing olfactory dendrites and facilitate their transfer to the odorant-receptor Orco complex. Required for cVA response, probably by binding to VA. May act by serving as an adapter that bridges the presence of gaseous pheromone molecules, cVA, to activation of specific neuronal receptors expressed on T1 olfactory neurons, possibly via a specific conformational change induced by cVA that in turn activates T1 receptors. T1 neurons are excited by the pheromone VA, while T2 neurons are inhibited by alcohols. Also binds to phthalates.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19.2 kDa
NCBI Official Full Name
lush, isoform B
NCBI Official Symbol
lush
NCBI Official Synonym Symbols
76a; 76c; 76c(LUSH); CG8807; DmelObp76a; DmelCG8807; Lush; LUSH; obp76a; Obp76a
NCBI Protein Information
CG8807 gene product from transcript CG8807-RA; CG8807-PA; CG8807-PB; lush; lush-PA; lush-PB
UniProt Protein Name
General odorant-binding protein lush
UniProt Gene Name
lush
UniProt Synonym Gene Names
Obp76a; Obp76c
UniProt Entry Name
OB76A_DROME
Similar Products
Product Notes
The lush lush (Catalog #AAA114456) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-153aa; Full Length of Mature Protein. The amino acid sequence is listed below: MTMEQFLTSL DMIRSGCAPK FKLKTEDLDR LRVGDFNFPP SQDLMCYTKC VSLMAGTVNK KGEFNAPKAL AQLPHLVPPE MMEMSRKSVE ACRDTHKQFK ESCERVYQTA KCFSENADGQ FMWP. It is sometimes possible for the material contained within the vial of "General odorant-binding protein lush (lush), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
