Odorant-binding protein 2a (OBP2A) Recombinant Protein | OBP2A recombinant protein
Recombinant Human Odorant-binding protein 2a (OBP2A)
Gene Names
                                                    OBP2A; OBP; LCN13; OBP2C; OBPIIa; hOBPIIa
                                                Purity
                                                    Greater or equal to 85% purity as determined by SDS-PAGE.
                                                Synonyms
                                            Odorant-binding protein 2a (OBP2A); N/A; Recombinant Human Odorant-binding protein 2a (OBP2A); Odorant-binding protein IIa; OBPIIa; OBP2A recombinant protein
                                        
                    Host                
                
                    E Coli or Yeast or Baculovirus or Mammalian Cell                
            
                    Purity/Purification                
                
                    Greater or equal to 85% purity as determined by SDS-PAGE.                
            
                    Form/Format                
                
                    Lyophilized or liquid (Format to be determined during the manufacturing process)                
            
                    Sequence Positions                
                
                    16-170aa; Full Length of Mature Protein                
            
                    Sequence                
                
                    LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH
                
            
                    Preparation and Storage                
                
                    Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.                
            
                    Related Product Information for OBP2A recombinant protein                
                
                 
                    Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.                 
                
            
                    Product Categories/Family for OBP2A recombinant protein                
                
            
                    References                
                
                    "A novel human odorant-binding protein gene family resulting from genomic duplicons at 9q34: differential expression in the oral and genital spheres." Lacazette E., Gachon A.-M., Pitiot G. Hum. Mol. Genet. 9:289-301(2000)                
            NCBI and Uniprot Product Information
                    NCBI GI #                
                
            
                    NCBI GeneID                
                
            
                    NCBI Accession #                
                
            
                    NCBI GenBank Nucleotide #                
                
            
                    Molecular Weight                
                
                                            33.8 kDa                                    
            
                    NCBI Official Full Name                
                
                    odorant-binding protein 2a isoform gamma                
            
                    NCBI Official Synonym Full Names                
                
                    odorant binding protein 2A                
            
                    NCBI Official Symbol                
                
                    OBP2A                 
            
                    NCBI Official Synonym Symbols                
                
                    OBP; LCN13; OBP2C; OBPIIa; hOBPIIa                 
            
                    NCBI Protein Information                
                
                    odorant-binding protein 2a                
            
                    UniProt Protein Name                
                
                    Odorant-binding protein 2a                
            
                    UniProt Gene Name                
                
                    OBP2A                
            
                    UniProt Synonym Gene Names                
                
                    OBPIIa                
            
                    UniProt Entry Name                
                
                    OBP2A_HUMAN                
            Similar Products
Product Notes
The OBP2A obp2a (Catalog #AAA18796) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 16-170aa; Full Length of Mature Protein. The amino acid sequence is listed below: LSFTLEEEDI TGTWYVKAMV VDKDFPEDRR PRKVSPVKVT ALGGGNLEAT FTFMREDRCI QKKILMRKTE EPGKFSAYGG RKLIYLQELP GTDDYVFYCK DQRRGGLRYM GKLVGRNPNT NLEALEEFKK LVQHKGLSEE DIFMPLQTGS CVLEH . It is sometimes possible for the material contained within the vial of "Odorant-binding protein 2a (OBP2A), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.

 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                