Lyve-1, soluble Recombinant Protein | Lyve1 recombinant protein
Mouse Lyve-1, soluble
Gene Names
Lyve1; Xlkd1; Lyve-1; Crsbp-1; 1200012G08Rik
Purity
> 95% by SDS-PAGE & silver stain
Synonyms
Lyve-1, soluble; N/A; Mouse Lyve-1, soluble; Recombinant Mouse Soluble LYVE-1-His; Lymphatic vessel endothelial hyaluronic acid receptor 1; Lyve1 recombinant protein
Host
Insect Cells
Purity/Purification
> 95% by SDS-PAGE & silver stain
Form/Format
Lyophilized; PBS
Sequence
ADLVQDLSISTCRIMGVALVGRNKNPQMNFTEANEACKMLGLTLASRDQVESAQKSGFETCSYGWVGEQFSVIPRIFSNPRCGKNGKGVLIWNAPSSQKFKAYCHNSSDTWVNSCIPEIVTTFYPVLTQTPATEFSVSSSAYLASSPDSTTPVSATTRAPPLTSMARKTKKICITEVYTEPITMATETEAFVASGAAFKNEAAGHHHHHH
Sequence Length
211
N Terminal Sequence
ADLVQDLS
Reconstitution
The lyophilized sLYVE-1 is soluble in water and most aqueous buffers. The lyophilized sLYVE-1 should be reconstituted in PBS or medium to a concentration not lower than 50ug/ml.
Length (aa)
211
Preparation and Storage
Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sLYVE-1 should be stored in working aliquots at -20°C.
Related Product Information for Lyve1 recombinant protein
A DNA sequence encoding the extracellular domain of mouse LYVE-1 (Met1 - Gly228) was fused to a C-terminal His-tag (6xHis) and expressed in insect cells. Based on N-terminal sequence analysis, the primary structure of recombinant mature sLYVE-1 starts at Ala24. sLYVE-1 has a calculated monomeric molecular mass of about 25 kDa but as a result of glycosylation, migrates at approximately 35 - 45 kDa under reducing conditions in SDS-PAGE. LYVE-1 has been identified as a major receptor for HA (extracellular matrix glycosaminoglycan hyaluronan) on the lymph vessel wall. The deduced amino acid sequence of LYVE-1 predicts a 322-residue type I integral membrane polypeptide 41% similar to the CD44 HA receptor with a 212-residue extracellular domain containing a single Link module the prototypic HA binding domain of the Link protein superfamily. Like CD44, the LYVE-1 molecule binds both soluble and immobilized HA. However, unlike CD44, the LYVE-1 molecule colocalizes with HA on the luminal face of the lymph vessel wall and is completely absent from blood vessels. Hence, LYVE-1 is the first lymph-specific HA receptor to be characterized and is a uniquely powerful marker for lymph vessels themselves.
Product Categories/Family for Lyve1 recombinant protein
References
1. Carriera et al., Cancer Res 61:8079, 2001 2. Jackson DG Trends Cardiovasc Med 13:1, 2003 3. Sleeman et al., Microsc Res Tech 55:61, 2001 4. Mäkinen et al., EMBO J 20 : 4762, 2001
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
35 - 45 kDa
NCBI Official Full Name
lymphatic vessel endothelial hyaluronic acid receptor 1
NCBI Official Synonym Full Names
lymphatic vessel endothelial hyaluronan receptor 1
NCBI Official Symbol
Lyve1
NCBI Official Synonym Symbols
Xlkd1; Lyve-1; Crsbp-1; 1200012G08Rik
NCBI Protein Information
lymphatic vessel endothelial hyaluronic acid receptor 1; extra cellular link domain-containing 1; lymphatic vessel endothelial HA recptor-1; lymphatic vessel endothelial HA receptor-1; extracellular link domain-containing protein 1; cell surface retention sequence binding protein-1; cell surface retention sequence-binding protein 1
UniProt Protein Name
Lymphatic vessel endothelial hyaluronic acid receptor 1
UniProt Gene Name
Lyve1
UniProt Synonym Gene Names
Crsbp1; Xlkd1; LYVE-1; CRSBP-1
UniProt Entry Name
LYVE1_MOUSE
Similar Products
Product Notes
The Lyve1 lyve1 (Catalog #AAA79273) is a Recombinant Protein produced from Insect Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: ADLVQDLSIS TCRIMGVALV GRNKNPQMNF TEANEACKML GLTLASRDQV ESAQKSGFET CSYGWVGEQF SVIPRIFSNP RCGKNGKGVL IWNAPSSQKF KAYCHNSSDT WVNSCIPEIV TTFYPVLTQT PATEFSVSSS AYLASSPDST TPVSATTRAP PLTSMARKTK KICITEVYTE PITMATETEA FVASGAAFKN EAAGHHHHHH. It is sometimes possible for the material contained within the vial of "Lyve-1, soluble, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
