B-Cell Receptor CD22 (CD22) Active Protein | CD22 active protein
Recombinant Human B-Cell Receptor CD22 (CD22), Partial (Active)
Gene Names
CD22; SIGLEC2; SIGLEC-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
B-Cell Receptor CD22 (CD22); N/A; Recombinant Human B-Cell Receptor CD22 (CD22), Partial (Active); B-lymphocyte cell adhesion molecule; BL-CAM; Sialic acid-binding Ig-like lectin 2; Siglec-2; T-cell surface antigen Leu-14; CD22; CD22 active protein
Host
Mammalian cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Sequence Positions
20-687aa; Partial
Sequence
DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR
Sequence Length
759
Species
Human
Tag
C-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized CD22 at 2 ug/ml can bind Anti-CD22 rabbit monoclonal antibody, the EC50 of human CD22 protein is 4.034-4.800 ng/ml.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for CD22 active protein
Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules.
Product Categories/Family for CD22 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77.9 kDa
NCBI Official Full Name
B-cell receptor CD22 isoform 2
NCBI Official Synonym Full Names
CD22 molecule
NCBI Official Symbol
CD22
NCBI Official Synonym Symbols
SIGLEC2; SIGLEC-2
NCBI Protein Information
B-cell receptor CD22
UniProt Protein Name
B-cell receptor CD22
UniProt Gene Name
CD22
UniProt Synonym Gene Names
SIGLEC2; BL-CAM; Siglec-2
UniProt Entry Name
CD22_HUMAN
Similar Products
Product Notes
The CD22 cd22 (Catalog #AAA243725) is an Active Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-687aa; Partial. The amino acid sequence is listed below: DSSKWVFEHP ETLYAWEGAC VWIPCTYRAL DGDLESFILF HNPEYNKNTS KFDGTRLYES TKDGKVPSEQ KRVQFLGDKN KNCTLSIHPV HLNDSGQLGL RMESKTEKWM ERIHLNVSER PFPPHIQLPP EIQESQEVTL TCLLNFSCYG YPIQLQWLLE GVPMRQAAVT STSLTIKSVF TRSELKFSPQ WSHHGKIVTC QLQDADGKFL SNDTVQLNVK HTPKLEIKVT PSDAIVREGD SVTMTCEVSS SNPEYTTVSW LKDGTSLKKQ NTFTLNLREV TKDQSGKYCC QVSNDVGPGR SEEVFLQVQY APEPSTVQIL HSPAVEGSQV EFLCMSLANP LPTNYTWYHN GKEMQGRTEE KVHIPKILPW HAGTYSCVAE NILGTGQRGP GAELDVQYPP KKVTTVIQNP MPIREGDTVT LSCNYNSSNP SVTRYEWKPH GAWEEPSLGV LKIQNVGWDN TTIACAACNS WCSWASPVAL NVQYAPRDVR VRKIKPLSEI HSGNSVSLQC DFSSSHPKEV QFFWEKNGRL LGKESQLNFD SISPEDAGSY SCWVNNSIGQ TASKAWTLEV LYAPRRLRVS MSPGDQVMEG KSATLTCESD ANPPVSHYTW FDWNNQSLPY HSQKLRLEPV KVQHSGAYWC QGTNSVGKGR SPLSTLTVYY SPETIGRR. It is sometimes possible for the material contained within the vial of "B-Cell Receptor CD22 (CD22), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
