B-Cell Receptor CD22 (CD22) Active Protein | CD22 active protein

Recombinant Human B-Cell Receptor CD22 (CD22), Partial (Active)

Cat. Num. AAA243725

• Gene Names: CD22; SIGLEC2; SIGLEC-2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: B-Cell Receptor CD22 (CD22); N/A; Recombinant Human B-Cell Receptor CD22 (CD22), Partial (Active); B-lymphocyte cell adhesion molecule; BL-CAM; Sialic acid-binding Ig-like lectin 2; Siglec-2; T-cell surface antigen Leu-14; CD22; CD22 active protein

• Host: Mammalian cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Sequence Positions: 20-687aa; Partial
• Sequence: DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR
• Sequence Length: 759

• Species: Human
• Tag: C-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized CD22 at 2 ug/ml can bind Anti-CD22 rabbit monoclonal antibody, the EC50 of human CD22 protein is 4.034-4.800 ng/ml.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Bioactivity

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Related Product Information for CD22 active protein

Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules.

Product Categories/Family for CD22 active protein

Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 297374825
• NCBI GeneID: 933
• NCBI Accession #: NP_001172028.1
• NCBI GenBank Nucleotide #: NP_001172028.1
• UniProt Accession #: P20273
• Molecular Weight: 77.9 kDa
• NCBI Official Full Name: B-cell receptor CD22 isoform 2
• NCBI Official Synonym Full Names: CD22 molecule
• NCBI Official Symbol: CD22
• NCBI Official Synonym Symbols: SIGLEC2; SIGLEC-2
• NCBI Protein Information: B-cell receptor CD22
• UniProt Protein Name: B-cell receptor CD22
• UniProt Gene Name: CD22
• UniProt Synonym Gene Names: SIGLEC2; BL-CAM; Siglec-2
• UniProt Entry Name: CD22_HUMAN