Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2?g/mL can bind Anti-CLEC4C recombinant antibody, the EC50 is 7.658-12.99 ng/mL.)
C-type lectin domain family 4 member C (CLEC4C) Active Protein | CLEC4C active protein
Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial (Active)
Gene Names
CLEC4C; DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
C-type lectin domain family 4 member C (CLEC4C); N/A; Recombinant Human C-type lectin domain family 4 member C (CLEC4C), partial (Active); Blood dendritic cell antigen 2; BDCA-2; C-type lectin superfamily member 7; Dendritic lectin; CD303; CLEC4C; BDCA2; CLECSF11; CLECSF7; DLEC; HECL; CLEC4C active protein
Host
Mammalian Cell
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Sequence Positions
45-213aa; Partial
Sequence
NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI$
Species
Homo sapiens (Human)
Tag
N-terminal 6xHis-Myc-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Immunology
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2 ug/mL can bind Anti-CLEC4C recombinant antibody, the EC50 is 7.658-12.99 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2?g/mL can bind Anti-CLEC4C recombinant antibody, the EC50 is 7.658-12.99 ng/mL.)
Bioactivity
(Measured by its binding ability in a functional ELISA. Immobilized Human CLEC4C at 2?g/mL can bind Anti-CLEC4C recombinant antibody, the EC50 is 7.658-12.99 ng/mL.)
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for CLEC4C active protein
May play a role in antigen capturing by dendritic cells.
Product Categories/Family for CLEC4C active protein
References
"Molecular and genomic characterization of human DLEC, a novel member of the C-type lectin receptor gene family preferentially expressed on monocyte-derived dendritic cells." Arce I., Roda-Navarro P., Montoya M.C., Hernanz-Falcon P., Puig-Kroger A., Fernandez-Ruiz E. Eur. J. Immunol. 31:2733-2740 (2001)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
25,038 Da
NCBI Official Full Name
C-type lectin domain family 4 member C isoform 2
NCBI Official Synonym Full Names
C-type lectin domain family 4, member C
NCBI Official Symbol
CLEC4C
NCBI Official Synonym Symbols
DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150
NCBI Protein Information
C-type lectin domain family 4 member C; BDCA-2; dendritic lectin; dendritic cell lectin b; C-type lectin superfamily member 7; blood dendritic cell antigen 2 protein; C-type lectin domain family 4, member C, isoform 1; C-type (calcium dependent, carbohydr
UniProt Protein Name
C-type lectin domain family 4 member C
UniProt Gene Name
CLEC4C
UniProt Synonym Gene Names
BDCA2; CLECSF11; CLECSF7; DLEC; HECL; BDCA-2
UniProt Entry Name
CLC4C_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CLEC4C clec4c (Catalog #AAA279252) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 45-213aa; Partial. The amino acid sequence is listed below: NFMYSKTVKR LSKLREYQQY HPSLTCVMEG KDIEDWSCCP TPWTSFQSSC YFISTGMQSW TKSQKNCSVM GADLVVINTR EEQDFIIQNL KRNSSYFLGL SDPGGRRHWQ WVDQTPYNEN VTFWHSGEPN NLDERCAIIN FRSSEEWGWN DIHCHVPQKS ICKMKKIYI$. It is sometimes possible for the material contained within the vial of "C-type lectin domain family 4 member C (CLEC4C), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.