SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Carcinoembryonic antigen-related cell adhesion molecule 5(CEACAM5) Active Protein | CEACAM5 active protein
Recombinant Macaca mulatta Carcinoembryonic antigen-related cell adhesion molecule 5(CEACAM5), partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
Carcinoembryonic antigen-related cell adhesion molecule 5(CEACAM5); N/A; Recombinant Macaca mulatta Carcinoembryonic antigen-related cell adhesion molecule 5(CEACAM5), partial (Active); CEACAM5 active protein
Host
Mammalian Cell
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Lyophilized powder; Lyophilized from a 0.2um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Sequence
MGSPSAPLHRWCIPWQTLLLTASLLTFWNPPTTAQLTIESRPFNVAEGKEVLLLAHNVSQNLFGYIWYKGERVDASRRIGSCVIRTQQITPGPAHSGRETIDFNASLLIHNVTQSDTGSYTIQVIKEDLVNEEATGQFRVYPELPKPYISSNNSNPVEDKDAVALTCEPETQDTTYLWWVNNQSLPVSPRLELSSDNRTLTVFNIPRNDTTSYKCETQNPVSVRRSDPVTLNVLYGPDAPTISPLNTPYRAGENLNLSCHAASNPTAQYFWFVNGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTAITVYAELPKPYITSNNSNPIEDKDAVTLTCEPETQDTTYLWWVNNQSLSVSSRLELSNDNRTLTVFNIPRNDTTFYECETQNPVSVRRSDPVTLNVLYGPDAPTISPLNTPYRAGENLNLSCHAASNPAAQYSWFVNGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTAITVYVELPKPYISSNNSNPIEDKDAVTLTCEPVAENTTYLWWVNNQSLSVSPRLQLSNGNRILTLLSVTRNDTGPYECGIQNSESAKRSDPVTLNVTYGPDTPIISPPDLSYRSGANLNLSCHSDSNPSPQYSWLINGTLRQHTQVLFISKITSNNNGAYACFVSNLATGRNNSIVKNISVSSGDSAPGSSG
Sequence Length
1-685aa; Partial
Species
Macaca mulatta (Rhesus macaque)
Tag
C-terminal 10xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CEACAM5 at 2ug/mL can bind Anti-CEACAM5 recombinant antibody . The EC50 is 3.572-4.044ng/mL.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
SDS-PAGE
((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Activity
Activity
Product Categories/Family for CEACAM5 active protein
NCBI and Uniprot Product Information
Molecular Weight
76.9kDa
Similar Products
Product Notes
The CEACAM5 (Catalog #AAA279375) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MGSPSAPLHR WCIPWQTLLL TASLLTFWNP PTTAQLTIES RPFNVAEGKE VLLLAHNVSQ NLFGYIWYKG ERVDASRRIG SCVIRTQQIT PGPAHSGRET IDFNASLLIH NVTQSDTGSY TIQVIKEDLV NEEATGQFRV YPELPKPYIS SNNSNPVEDK DAVALTCEPE TQDTTYLWWV NNQSLPVSPR LELSSDNRTL TVFNIPRNDT TSYKCETQNP VSVRRSDPVT LNVLYGPDAP TISPLNTPYR AGENLNLSCH AASNPTAQYF WFVNGTFQQS TQELFIPNIT VNNSGSYMCQ AHNSATGLNR TTVTAITVYA ELPKPYITSN NSNPIEDKDA VTLTCEPETQ DTTYLWWVNN QSLSVSSRLE LSNDNRTLTV FNIPRNDTTF YECETQNPVS VRRSDPVTLN VLYGPDAPTI SPLNTPYRAG ENLNLSCHAA SNPAAQYSWF VNGTFQQSTQ ELFIPNITVN NSGSYMCQAH NSATGLNRTT VTAITVYVEL PKPYISSNNS NPIEDKDAVT LTCEPVAENT TYLWWVNNQS LSVSPRLQLS NGNRILTLLS VTRNDTGPYE CGIQNSESAK RSDPVTLNVT YGPDTPIISP PDLSYRSGAN LNLSCHSDSN PSPQYSWLIN GTLRQHTQVL FISKITSNNN GAYACFVSNL ATGRNNSIVK NISVSSGDSA PGSSG. It is sometimes possible for the material contained within the vial of "Carcinoembryonic antigen-related cell adhesion molecule 5(CEACAM5), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.