Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA279208_BIOACTIVITY13.jpg Bioactivity (Measured by its binding ability in a functional ELISA. Immobilized Human DKK1 at 2 ?g/mL can bind Anti-DKK1 recombinant antibody, the EC50 is 1.283-2.544 ng/mL.)

Dickkopf-related protein 1 (DKK1) Active Protein | DKK1 active protein

Recombinant Human Dickkopf-related protein 1 (DKK1)(Active)

Average rating 0.0
No ratings yet
Gene Names
DKK1; SK; DKK-1
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
Dickkopf-related protein 1 (DKK1); N/A; Recombinant Human Dickkopf-related protein 1 (DKK1)(Active); Dickkopf-1; Dkk-1; hDkk-1; SK; DKK1 active protein
Ordering
Host
Mammalian Cell
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Sequence Positions
32-266aa; Full Length of Mature Protein
Sequence
TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH$
Species
Homo sapiens (Human)
Tag
C-terminal 10xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Cardiovascular
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human DKK1 at 2 ug/mL can bind Anti-DKK1 recombinant antibody, the EC50 is 1.283-2.544 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Bioactivity

(Measured by its binding ability in a functional ELISA. Immobilized Human DKK1 at 2 ?g/mL can bind Anti-DKK1 recombinant antibody, the EC50 is 1.283-2.544 ng/mL.)

product-image-AAA279208_BIOACTIVITY13.jpg Bioactivity (Measured by its binding ability in a functional ELISA. Immobilized Human DKK1 at 2 ?g/mL can bind Anti-DKK1 recombinant antibody, the EC50 is 1.283-2.544 ng/mL.)

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

product-image-AAA279208_SDS_PAGE15.jpg SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for DKK1 active protein
Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6.DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.Inhibits the pro-apoptotic function of KREMEN1 in a Wnt-independent manner, and has anti-apoptotic activity.
Product Categories/Family for DKK1 active protein
References
"Regulation of Wnt/LRP signaling by distinct domains of Dickkopf proteins."Brott B.K., Sokol S.Y.Mol Cell Biol 22:6100-6110(2002)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,672 Da
NCBI Official Full Name
dickkopf-related protein 1
NCBI Official Synonym Full Names
dickkopf WNT signaling pathway inhibitor 1
NCBI Official Symbol
DKK1
NCBI Official Synonym Symbols
SK; DKK-1
NCBI Protein Information
dickkopf-related protein 1; hDkk-1; dickkopf-1 like; dickkopf 1 homolog; dickkopf-like protein 1; dickkopf related protein-1
UniProt Protein Name
Dickkopf-related protein 1
UniProt Gene Name
DKK1
UniProt Synonym Gene Names
Dickkopf-1; Dkk-1; hDkk-1
UniProt Entry Name
DKK1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DKK1 dkk1 (Catalog #AAA279208) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 32-266aa; Full Length of Mature Protein. The amino acid sequence is listed below: TLNSVLNSNA IKNLPPPLGG AAGHPGSAVS AAPGILYPGG NKYQTIDNYQ PYPCAEDEEC GTDEYCASPT RGGDAGVQIC LACRKRRKRC MRHAMCCPGN YCKNGICVSS DQNHFRGEIE ETITESFGND HSTLDGYSRR TTLSSKMYHT KGQEGSVCLR SSDCASGLCC ARHFWSKICK PVLKEGQVCT KHRRKGSHGL EIFQRCYCGE GLSCRIQKDH HQASNSSRLH TCQRH$. It is sometimes possible for the material contained within the vial of "Dickkopf-related protein 1 (DKK1), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.