Interleukin-4 receptor subunit alpha (IL4R) Active Protein | IL4R active protein
Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial, Biotinylated (Active)
Gene Names
IL4R; CD124; IL4RA; IL-4RA
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
Interleukin-4 receptor subunit alpha (IL4R); N/A; Recombinant Human Interleukin-4 receptor subunit alpha (IL4R), partial, Biotinylated (Active); IL4RA; 582J2.1; IL4R active protein
Host
Mammalian Cell
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Lyophilized powder
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Sequence Positions
26-232aa; Partial
Sequence
MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH$
Species
Homo sapiens (Human)
Tag
C-terminal 10xHis-Avi-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Research Area
Cancer
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IL4 at 2 ug/mL can bind biotinylated Human IL4R. The EC50 is 12.68-14.23 ng/mL.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Related Product Information for IL4R active protein
May couple to the JAK1/2/3-STAT6 pathway and promote Th2 differentiation.In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.
Product Categories/Family for IL4R active protein
References
"Human interleukin 4 receptor confers biological responsiveness and defines a novel receptor superfamily."Idzerda R.L., March C.J., Mosley B., Lyman S.D., Bos T.V., Gimpel S.D., Din W.S., Grabstein K.H., Widmer M.B., Beckmann M.P.J. Exp. Med. 171:861-873 (1990)"Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q."Loftus B.J., Kim U.-J., Sneddon V.P., Kalush F., Brandon R., Fuhrmann J., Mason T., Crosby M.L., Barnstead M., Adams M.D.Genomics 60:295-308 (1999)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
89,658 Da
NCBI Official Full Name
interleukin-4 receptor subunit alpha isoform a
NCBI Official Synonym Full Names
interleukin 4 receptor
NCBI Official Symbol
IL4R
NCBI Official Synonym Symbols
CD124; IL4RA; IL-4RA
NCBI Protein Information
interleukin-4 receptor subunit alpha; IL4R nirs variant 1; IL-4 receptor subunit alpha; interleukin-4 receptor alpha chain
UniProt Protein Name
Interleukin-4 receptor subunit alpha
UniProt Gene Name
IL4R
UniProt Synonym Gene Names
IL4RA; IL-4 receptor subunit alpha; IL-4R subunit alpha; IL-4R-alpha; IL-4RA; Soluble IL-4 receptor subunit alpha; Soluble IL-4R-alpha; sIL4Ralpha/prot; IL4-BP
UniProt Entry Name
IL4RA_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The IL4R il4r (Catalog #AAA279215) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-232aa; Partial. The amino acid sequence is listed below: MKVLQEPTCV SDYMSISTCE WKMNGPTNCS TELRLLYQLV FLLSEAHTCI PENNGGAGCV CHLLMDDVVS ADNYTLDLWA GQQLLWKGSF KPSEHVKPRA PGNLTVHTNV SDTLLLTWSN PYPPDNYLYN HLTYAVNIWS ENDPADFRIY NVTYLEPSLR IAASTLKSGI SYRARVRAWA QCYNTTWSEW SPSTKWHNSY REPFEQH$. It is sometimes possible for the material contained within the vial of "Interleukin-4 receptor subunit alpha (IL4R), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
