Kit ligand (KITLG) Active Protein | KITLG active protein

Recombinant Human Kit ligand (KITLG), partial (Active)

Cat. Num. AAA279357

• Gene Names: KITLG; SF; MGF; SCF; FPH2; KL-1; Kitl; SHEP7
• Purity: Greater than 95% as determined by SDS-PAGE.
• Synonyms: Kit ligand (KITLG); N/A; Recombinant Human Kit ligand (KITLG), partial (Active); Kit ligand; Mast cell growth factor; Stem cell factor; c-Kit ligand; Soluble KIT ligand; KITLG active protein

• Host: Mammalian Cell
• Purity/Purification: Greater than 95% as determined by SDS-PAGE.
• Form/Format: Lyophilized powder; Lyophilized from a 0.2um sterile filtered PBS, 6% Trehalose, pH 7.4
• Sequence: EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA
• Sequence Length: 26-189aa; Partial

• Species: Homo sapiens (Human)
• Tag: C-terminal 10xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by the dose-dependent stimulation of the proliferation of MO7e cells is 1.813-3.203ng/mL.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Preparation and Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.; Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Activity

Related Product Information for KITLG active protein

Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Product Categories/Family for KITLG active protein

Immunology

References

The full-ORF clone resource of the German cDNA consortium. Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Schupp I.BMC Genomics 8:399-399 (2007)

NCBI and Uniprot Product Information

• NCBI GI #: 4505175
• NCBI GeneID: 4254
• NCBI Accession #: NP_000890.1
• NCBI GenBank Nucleotide #: NM_000899.4
• UniProt Accession #: P21583; Q16487; Q68DZ2; Q7M4N8; Q9UQK7; A0AV09; A8K2Q4; B7ZLM4
• Molecular Weight: 273
• NCBI Official Full Name: kit ligand isoform b
• NCBI Official Synonym Full Names: KIT ligand
• NCBI Official Symbol: KITLG
• NCBI Official Synonym Symbols: SF; MGF; SCF; FPH2; KL-1; Kitl; SHEP7
• NCBI Protein Information: kit ligand; c-Kit ligand; steel factor; stem cell factor; mast cell growth factor; familial progressive hyperpigmentation 2
• UniProt Protein Name: Kit ligand
• UniProt Gene Name: KITLG
• UniProt Synonym Gene Names: MGF; SCF; MGF; SCF; sKITLG
• UniProt Entry Name: SCF_HUMAN