Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA279365_SDS_PAGE13.jpg SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Thymic stromal lymphopoietin (TSLP)(R127A,R130A) Active Protein | R127A active protein

Recombinant Human Thymic stromal lymphopoietin (TSLP)(R127A,R130A)(Active)

Average rating 0.0
No ratings yet
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
Thymic stromal lymphopoietin (TSLP)(R127A,R130A); N/A; Recombinant Human Thymic stromal lymphopoietin (TSLP)(R127A,R130A)(Active); TSLP (R127A,R130A); R127A active protein
Ordering
Host
Mammalian Cell
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
Lyophilized powder; Lyophilized from a 0.2um sterile filtered PBS, 6% Trehalose, pH 7.4
Sequence
YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKARKAKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Sequence Length
29-159aa(R127A,R130A); Full Length of Mature Protein
Species
Homo sapiens (Human)
Tag
C-terminal 10xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized human TSLP (R127A,R130A) at 2ug/mL can bind Anti-TSLP recombinant antibody . The EC50 is 52.55-58.67ng/mL.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 degree C/-80 degree C. The shelf life of lyophilized form is 12 months at -20 degree C/-80 degree C.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

product-image-AAA279365_SDS_PAGE13.jpg SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Activity

product-image-AAA279365_ACTIVITY15.jpg Activity
Related Product Information for R127A active protein
Isoform 1Cytokine that induces the release of T-cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c+ dendritic cells. Can induce allergic inflammation by directly activating mast cells.Isoform 2May act as an antimicrobial peptide in the oral cavity and on the skin.
Product Categories/Family for R127A active protein
References
Human thymic stromal lymphopoietin preferentially stimulates myeloid cells. Reche P.A., Soumelis V., Gorman D.M., Clifford T., Liu M.-R., Travis M., Zurawski S.M., Johnston J., Liu Y.-J., Bazan J.F.J. Immunol. 167:336-343 (2001)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,141 Da
NCBI Official Full Name
thymic stromal lymphopoietin isoform 2
NCBI Official Synonym Full Names
thymic stromal lymphopoietin
NCBI Official Symbol
TSLP
NCBI Protein Information
thymic stromal lymphopoietin
UniProt Protein Name
Thymic stromal lymphopoietin
UniProt Gene Name
TSLP
UniProt Entry Name
TSLP_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The R127A tslp (Catalog #AAA279365) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: YDFTNCDFEK IKAAYLSTIS KDLITYMSGT KSTEFNNTVS CSNRPHCLTE IQSLTFNPTA GCASLAKEMF AMKTKAALAI WCPGYSETQI NATQAMKKAR KAKVTTNKCL EQVSQLQGLW RRFNRPLLKQ Q. It is sometimes possible for the material contained within the vial of "Thymic stromal lymphopoietin (TSLP)(R127A,R130A), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.