Tumor Necrosis Factor Receptor Superfamily Member 17 (TNFRSF17) Active Protein | Tnfrsf17 active protein
Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 17 (TNFRSF17), Partial (Active)
Gene Names
TNFRSF17; BCM; BCMA; CD269; TNFRSF13A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor Necrosis Factor Receptor Superfamily Member 17 (TNFRSF17); N/A; Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 17 (TNFRSF17), Partial (Active); B-cell maturation protein; CD_antigen: CD269; Tnfrsf17 active protein
Host
Mammalian cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered PBS, 6% Trehalose, pH 7.4
Sequence Positions
1-54aa; Partial
Sequence
MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Sequence Length
184
Species
Human
Tag
C-terminal FC-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
1. Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 ?g/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml.
2. Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B (MBS7136887) at 10 ?g/ml can bind human BCMA, the EC50 of human BCMA protein is 221.3-298.6 ng/ml.
3. Human TNFSF13B protein Fc tag (MBS7136887) captured on COOH chip can bind Human BCMA protein Fc tag (CSB-MP023974HU1) with an affinity constant of 39 nM as detected by LSPR Assay.
4. Measured by its binding ability in a functional ELISA. Immobilized human BCMA at 5 ?g/ml can bind Biotinylated human TNFSF13B (MBS7136887), the EC50 is 0.1752-0.3657 ng/ml.
2. Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B (MBS7136887) at 10 ?g/ml can bind human BCMA, the EC50 of human BCMA protein is 221.3-298.6 ng/ml.
3. Human TNFSF13B protein Fc tag (MBS7136887) captured on COOH chip can bind Human BCMA protein Fc tag (CSB-MP023974HU1) with an affinity constant of 39 nM as detected by LSPR Assay.
4. Measured by its binding ability in a functional ELISA. Immobilized human BCMA at 5 ?g/ml can bind Biotinylated human TNFSF13B (MBS7136887), the EC50 is 0.1752-0.3657 ng/ml.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Tnfrsf17 active protein
Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity.
Product Categories/Family for Tnfrsf17 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34.8 kDa
NCBI Official Full Name
tumor necrosis factor receptor superfamily member 17
NCBI Official Synonym Full Names
TNF receptor superfamily member 17
NCBI Official Symbol
TNFRSF17
NCBI Official Synonym Symbols
BCM; BCMA; CD269; TNFRSF13A
NCBI Protein Information
tumor necrosis factor receptor superfamily member 17
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 17
UniProt Gene Name
TNFRSF17
UniProt Synonym Gene Names
BCM; BCMA
UniProt Entry Name
TNR17_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Tnfrsf17 tnfrsf17 (Catalog #AAA243734) is an Active Protein produced from Mammalian cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-54aa; Partial. The amino acid sequence is listed below: MLQMAGQCSQ NEYFDSLLHA CIPCQLRCSS NTPPLTCQRY CNASVTNSVK GTNA. It is sometimes possible for the material contained within the vial of "Tumor Necrosis Factor Receptor Superfamily Member 17 (TNFRSF17), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
