Interferon alpha-2 Active Protein | IFNA2 active protein

Recombinant Human Interferon alpha-2

Cat. Num. AAA114580

• Gene Names: IFNA2; IFNA; INFA2; IFNA2B; IFN-alphaA
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interferon alpha-2; N/A; Recombinant Human Interferon alpha-2; Interferon alpha-A; LeIF A; IFNA2 active protein

• Host: Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 24-188aa; Full Length
• Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
• Sequence Length: 188

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for IFNA2 active protein

Produced by macrophages, IFN-alpha have antiviral activities.

Product Categories/Family for IFNA2 active protein

Cancer

References

Human leukocyte interferon produced by E. coli is biologically active.Goeddel D.V., Yelverton E., Ullrich A., Heyneker H.L., Miozzari G., Holmes W., Seeburg P.H., Dull T.J., May L., Stebbing N., Crea R., Maeda S., McCandliss R., Sloma A., Tabor J.M., Gross M., Familletti P.C., Pestka S.Nature 287:411-416(1980) The structure of eight distinct cloned human leukocyte interferon cDNAs.Goeddel D.V., Leung D.W., Dull T.J., Gross M., Lawn R.M., McCandliss R., Seeburg P.H., Ullrich A., Yelverton E., Gray P.W.Nature 290:20-26(1981) DNA sequence of a major human leukocyte interferon gene.Lawn R.M., Gross M., Houck C.M., Franke A.E., Gray P.V., Goeddel D.V.Proc. Natl. Acad. Sci. U.S.A. 78:5435-5439(1981) Cloning of human leukocyte interferon cDNA and a strategy for its production in E. coli.Oliver G., Balbas P., Valle F., Soberon X., Bolivar F.Rev. Latinoam. Microbiol. 27:141-150(1985) A defective retroviral vector encoding human interferon alpha 2 can transduce human leukemic cell lines.Austruy E., Bagnis C., Carbuccia N., Maroc C., Birg F., Dubreuil P., Mannoni P., Chabannon C.Cancer Gene Ther. 5:247-256(1998) Heterologous expression, immunochemical and computational analysis of recombinant human interferon alpha 2b.Gull I., Samra Z.Q., Aslam M.S., Athar M.A.Springerplus 2:264-264(2013) Hanif K., Noor S., Naveed Y., Bashir B., Hussain T., Kanwal N. Intermolecular interactions in a 44 kDa interferon-receptor complex detected by asymmetric reverse-protonation and two-dimensional NOESY.Nudelman I., Akabayov S.R., Schnur E., Biron Z., Levy R., Xu Y., Yang D., Anglister J.Biochemistry 49:5117-5133(2010) The consensus coding sequences of human breast and colorectal cancers.Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.Science 314:268-274(2006)

NCBI and Uniprot Product Information

• NCBI GI #: 11067751
• NCBI GeneID: 3440
• NCBI Accession #: NP_000596.2
• NCBI GenBank Nucleotide #: NM_000605.3
• UniProt Accession #: P01563; P01564; Q14606; Q6DJX8; Q96KI6; H2DF54; H2DF55
• Molecular Weight: 21.2 kDa
• NCBI Official Full Name: interferon alpha-2
• NCBI Official Synonym Full Names: interferon, alpha 2
• NCBI Official Symbol: IFNA2
• NCBI Official Synonym Symbols: IFNA; INFA2; IFNA2B; IFN-alphaA
• NCBI Protein Information: interferon alpha-2
• UniProt Protein Name: Interferon alpha-2
• UniProt Gene Name: IFNA2
• UniProt Synonym Gene Names: IFNA2A; IFNA2B; IFNA2C; IFN-alpha-2; LeIF A
• UniProt Entry Name: IFNA2_HUMAN