Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA244033_BIOACTIVITY13.png Bioactivity

Spike glycoprotein (S) Active Protein | S1-RBD active protein

Recombinant Human Novel Coronavirus Spike glycoprotein (S), partial

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Spike glycoprotein (S); N/A; Recombinant Human Novel Coronavirus Spike glycoprotein (S), partial; Spike glycoprotein; S1-RBD active protein
Ordering
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH8.0
Lyophilized or liquid (Format to be determined during the manufa
Sequence Positions
319-541aa (V483A), Partial
Sequence
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGAEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Species
SARS-CoV-2
Endotoxin
Less than 1.0EU/ug as determined by LAL method.
Biological Activity
1: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 5ug/ml can bind human ACE2, the EC50 is 196.4-272.1ng/ml.
2: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V483A) at 2ug/ml can bind SARS-CoV-2-S Antibody, the EC50 is 7.481-18.76ng/ml.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C.
Store working aliquots at 4 degrees C for up to one week.
Repeated freezing and thawing is not recommended.

Bioactivity

product-image-AAA244033_BIOACTIVITY13.png Bioactivity

Activity

product-image-AAA244033_ACTIVITY15.jpg Activity
Related Product Information for S1-RBD active protein
The recombinant human novel coronavirus spike glycoprotein (S) (V483A) was generated by the expression of a DNA fragment encoding 319-541AA of human SRAS-CoV-2-S in the mammalian cell. The partial-length protein carries a C-terminal 10xHis-tag. It reached up to 90% in purity determined by SDS-PAGE. It was also verified to be fully biologically active through its interaction with ACE2 and SARS-CoV-2-S Antibody. The endotoxin of this SRAS-CoV-2-S is less than 1.0 EU/ug measured by the LAL method. This recombinant SARS0CoV-2-S protein may be used in the studies of the microbiology research area.

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
35kDa

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The S1-RBD (Catalog #AAA244033) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 319-541aa (V483A), Partial. The amino acid sequence is listed below: RVQPTESIVR FPNITNLCPF GEVFNATRFA SVYAWNRKRI SNCVADYSVL YNSASFSTFK CYGVSPTKLN DLCFTNVYAD SFVIRGDEVR QIAPGQTGKI ADYNYKLPDD FTGCVIAWNS NNLDSKVGGN YNYLYRLFRK SNLKPFERDI STEIYQAGST PCNGAEGFNC YFPLQSYGFQ PTNGVGYQPY RVVVLSFELL HAPATVCGPK KSTNLVKNKC VNF. It is sometimes possible for the material contained within the vial of "Spike glycoprotein (S), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.