Muscleblind-like protein 1 (MBNL1) Recombinant Protein | MBNL1 recombinant protein

Recombinant Human Muscleblind-like protein 1 (MBNL1)

Cat. Num. AAA116568

• Gene Names: MBNL1; EXP; MBNL
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Muscleblind-like protein 1 (MBNL1); N/A; Recombinant Human Muscleblind-like protein 1 (MBNL1); Triplet-expansion RNA-binding protein; MBNL1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-382aa; Full Length of Isoform 5
• Sequence: MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for MBNL1 recombinant protein

Mediates pre-mRNA alternative splicing regulation. Acts either as activator or repressor of splicing on specific pre-mRNA targets. Inhibits cardiac troponin-T (TNNT2) pre-mRNA exon inclusion but induces insulin receptor (IR) pre-mRNA exon inclusion in muscle. Antagonizes the alternative splicing activity pattern of CELF proteins. Regulates the TNNT2 exon 5 skipping through competition with U2AF2. Inhibits the formation of the spliceosome A complex on intron 4 of TNNT2 pre-mRNA. Binds to the st-loop structure within the polypyrimidine tract of TNNT2 intron 4 during spliceosome assembly. Binds to the 5'-YGCU(U/G)Y-3'consensus sequence. Binds to the IR RNA. Binds to expanded CUG repeat RNA, which folds into a hairpin structure containing GC base pairs and bulged, unpaired U residues.

Product Categories/Family for MBNL1 recombinant protein

Transcription

References

Borsani G., Barbieri A.Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro.Ishikawa K., Nagase T., Nakajima D., Seki N., Ohira M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.DNA Res. 4:307-313(1997) Recruitment of human muscleblind proteins to (CUG) (n) expansions associated with myotonic dystrophy.Miller J.W., Urbinati C.R., Teng-Umnuay P., Stenberg M.G., Byrne B.J., Thornton C.A., Swanson M.S.EMBO J. 19:4439-4448(2000) Muscleblind localizes to nuclear foci of aberrant RNA in myotonic dystrophy types 1 and 2.Mankodi A., Urbinati C.R., Yuan Q.P., Moxley R.T., Sansone V., Krym M., Henderson D., Schalling M., Swanson M.S., Thornton C.A.Hum. Mol. Genet. 10:2165-2170(2001) Study of the role of the MBNL gene in the origin myotonic dystrophies in humans.Pascual M., Terol J., Perez-Alonso M. Direct evidence that EXP/muscleblind interacts with CCUG tetranucleotide repeats.Kino Y., Ishiura S. The DNA sequence, annotation and analysis of human chromosome 3.Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.Nature 440:1194-1198(2006) Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C. Three proteins, MBNL, MBLL and MBXL, co-localize in vivo with nuclear foci of expanded-repeat transcripts in DM1 and DM2 cells.Fardaei M., Rogers M.T., Thorpe H.M., Larkin K., Hamshere M.G., Harper P.S., Brook J.D.Hum. Mol. Genet. 11:805-814(2002) Muscleblind proteins regulate alternative splicing.Ho T.H., Charlet-B N., Poulos M.G., Singh G., Swanson M.S., Cooper T.A.EMBO J. 23:3103-3112(2004) Interaction of muscleblind, CUG-BP1 and hnRNP H proteins in DM1-associated aberrant IR splicing.Paul S., Dansithong W., Kim D., Rossi J., Webster N.J., Comai L., Reddy S.EMBO J. 25:4271-4283(2006) MBNL1 associates with YB-1 in cytoplasmic stress granules.Onishi H., Kino Y., Morita T., Futai E., Sasagawa N., Ishiura S.J. Neurosci. Res. 86:1994-2002(2008) The protein factors MBNL1 and U2AF65 bind alternative RNA structures to regulate splicing.Warf M.B., Diegel J.V., von Hippel P.H., Berglund J.A.Proc. Natl. Acad. Sci. U.S.A. 106:9203-9208(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) Structural insights into RNA recognition by the alternative-splicing regulator muscleblind-like MBNL1.Teplova M., Patel D.J.Nat. Struct. Mol. Biol. 15:1343-1351(2008)

NCBI and Uniprot Product Information

• NCBI GI #: 930945856
• NCBI GeneID: 4154
• NCBI Accession #: NP_001300986.1
• NCBI GenBank Nucleotide #: NM_001314057.1
• UniProt Accession #: Q9NR56; O43311; O43797; Q86UV8; Q86UV9; Q96P92; Q96RE3; E9PBW7
• Molecular Weight: 57 kDa
• NCBI Official Full Name: muscleblind-like protein 1 isoform h
• NCBI Official Synonym Full Names: muscleblind like splicing regulator 1
• NCBI Official Symbol: MBNL1
• NCBI Official Synonym Symbols: EXP; MBNL
• NCBI Protein Information: muscleblind-like protein 1
• UniProt Protein Name: Muscleblind-like protein 1
• UniProt Gene Name: MBNL1
• UniProt Synonym Gene Names: EXP; KIAA0428; MBNL
• UniProt Entry Name: MBNL1_HUMAN