SDS-PAGE
Membrane-bound transcription factor site-1 protease (MBTPS1), partial Recombinant Protein | MBTPS1 recombinant protein
Recombinant Human Membrane-bound transcription factor site-1 protease (MBTPS1), partial
Gene Names
MBTPS1; S1P; PCSK8; SKI-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Membrane-bound transcription factor site-1 protease (MBTPS1), partial; N/A; Recombinant Human Membrane-bound transcription factor site-1 protease (MBTPS1), partial; Membrane-bound transcription factor site-1 protease; EC=3.4.21.112; Endopeptidase S1P; Subtilisin/kexin-isozyme 1; SKI-1; MBTPS1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
218-414aa; Partial
Sequence
DTGLSEKHPHFKNVKERTNWTNERTLDDGLGHGTFVAGVIASMRECQGFAPDAELHIFRVFTNNQVSYTSWFLDAFNYAILKKIDVLNLSIGGPDFMDHPFVDKVWELTANNVIMVSAIGNDGPLYGTLNNPADQMDVIGVGGIDFEDNIARFSSRGMTTWELPGGYGRMKPDIVTYGAGVRGSGVKGGCRALSGTS
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-PAGE
SDS-PAGE
Related Product Information for MBTPS1 recombinant protein
Serine protease that catalyzes the first step in the proteolytic activation of the sterol regulatory element-binding proteins (SREBPs). Other known substrates are BDNF, GNPTAB and ATF6. Cleaves after hydrophobic or small residues, provided that Arg or Lys is in position P4. Cleaves known substrates after Arg-Ser-Val-Leu (SERBP-2), Arg-His-Leu-Leu (ATF6), Arg-Gly-Leu-Thr (BDNF) and its own propeptide after Arg-Arg-Leu-Leu. Mediates the protein cleavage of GNPTAB into subunit alpha and beta, thereby participating in biogenesis of lysosomes.
Product Categories/Family for MBTPS1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
37.5 kDa
NCBI Official Full Name
membrane-bound transcription factor site-1 protease preproprotein
NCBI Official Synonym Full Names
membrane-bound transcription factor peptidase, site 1
NCBI Official Symbol
MBTPS1
NCBI Official Synonym Symbols
S1P; PCSK8; SKI-1
NCBI Protein Information
membrane-bound transcription factor site-1 protease; endopeptidase S1P; subtilisin/kexin isozyme-1; proprotein convertase subtilisin/kexin type 8
UniProt Protein Name
Membrane-bound transcription factor site-1 protease
UniProt Gene Name
MBTPS1
UniProt Synonym Gene Names
KIAA0091; S1P; SKI1; SKI-1
UniProt Entry Name
MBTP1_HUMAN
Similar Products
Product Notes
The MBTPS1 mbtps1 (Catalog #AAA117485) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 218-414aa; Partial. The amino acid sequence is listed below: DTGLSEKHPH FKNVKERTNW TNERTLDDGL GHGTFVAGVI ASMRECQGFA PDAELHIFRV FTNNQVSYTS WFLDAFNYAI LKKIDVLNLS IGGPDFMDHP FVDKVWELTA NNVIMVSAIG NDGPLYGTLN NPADQMDVIG VGGIDFEDNI ARFSSRGMTT WELPGGYGRM KPDIVTYGAG VRGSGVKGGC RALSGTS. It is sometimes possible for the material contained within the vial of "Membrane-bound transcription factor site-1 protease (MBTPS1), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.