Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA55961_SDS_PAGE15.jpg SDS-PAGE

mCherry recombinant protein

Recombinant Human mCherry Protein

Applications
ELISA, Western Blot
Purity
> 90 % as determined by SDS-PAGE.
Synonyms
mCherry; N/A; Recombinant Human mCherry Protein; MCherry; mCherry recombinant protein
Ordering
Host
E Coli
Purity/Purification
> 90 % as determined by SDS-PAGE.
Form/Format
The protein was expressed as 6XHis-tagged fusion protein by E .Coli and purified by NI-sepharose. The purified protein was resolved in PBS (58 mM Na2HPO4,17 mM NaH2PO4, 68 mM NaCl, pH 7.4) added with 15% glycerol. The elution buffer contain 300 mM imidazo
Concentration
0.5 mg/mL (varies by lot)
Sequence
VSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
Sequence Length
228
Applicable Applications for mCherry recombinant protein
ELISA, WB (Western Blot)
Source
Human
Protein Residues
with N-terminal 6*His-tagged.

SDS-PAGE

product-image-AAA55961_SDS_PAGE15.jpg SDS-PAGE
Related Product Information for mCherry recombinant protein
mCherry is a fluorophore (a fluorescent molecule) used in biotechnology as a tracer to follow the flow of fluids, as a marker when tagged to molecules and cells components. mCherry is a monomeric fluorescent construct with peak absorption/emission at 587 nm and 610 nm, respectively. It is resistant to photobleaching and is stable. mCherry is sometimes preferred to other fluorophores due to its colour, as well as its photostability compared to other monomeric fluorophores.

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
Predicted MW: 36 kDa
Observed MW: 36 kDa
NCBI Official Full Name
mCherry

Similar Products

Product Notes

The mCherry (Catalog #AAA55961) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's mCherry can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the mCherry for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VSKGEEDNMA IIKEFMRFKV HMEGSVNGHE FEIEGEGEGR PYEGTQTAKL KVTKGGPLPF AWDILSPQFM YGSKAYVKHP ADIPDYLKLS FPEGFKWERV MNFEDGGVVT VTQDSSLQDG EFIYKVKLRG TNFPSDGPVM QKKTMGWEAS SERMYPEDGA LKGEIKQRLK LKDGGHYDAE VKTTYKAKKP VQLPGAYNVN IKLDITSHNE DYTIVEQYER AEGRHSTGGM DELYK. It is sometimes possible for the material contained within the vial of "mCherry, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.