Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Matrix metalloproteinase-20 (Mmp20) Recombinant Protein | Mmp20 recombinant protein

Recombinant Mouse Matrix metalloproteinase-20 (Mmp20)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Matrix metalloproteinase-20 (Mmp20); N/A; Recombinant Mouse Matrix metalloproteinase-20 (Mmp20); Mmp20 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
107-482aa; Full Length of Mature Protein
Sequence
YRLFPGEPKWKKNILTYRISKYTPSMSPTEVDKAIQMALHAWSTAVPLNFVRINSGEADIMISFETGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLGHSTDPSALMYPTYKYQNPYRFHLPKDDVKGIQALYGPRKIFPGKPTMPHIPPHKPSIPDLCDSSSSFDAVTMLGKELLFFKDRIFWRRQVHLPTGIRPSTITSSFPQLMSNVDAAYEVAERGIAFFFKGPHYWVTRGFHMQGPPRTIYDFGFPRHVQRIDAAVYLKEPQKTLFFVGEEYYSYDERKKKMEKDYPKNTEEEFSGVSGHIDAAVELNGYIYFFSGRKTFKYDTEKEDVVSVVKSSSWIGC
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Mmp20 recombinant protein
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP s are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This protein degrades amelogenin, the major protein component of dental enamel matrix, and so the protein is thought to play a role in tooth enamel formation. A mutation in this gene, which alters the normal splice pattern and results in premature termination of the encoded protein, has been associated with amelogenesis imperfecta. This gene is part of a cluster of MMP genes that localizes to chromosome 11q22.3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54,373 Da
NCBI Official Full Name
matrix metalloproteinase-20 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 20 (enamelysin)
NCBI Official Symbol
Mmp20
NCBI Protein Information
matrix metalloproteinase-20
UniProt Protein Name
Matrix metalloproteinase-20
UniProt Gene Name
Mmp20
UniProt Synonym Gene Names
MMP-20

Similar Products

Product Notes

The Mmp20 mmp20 (Catalog #AAA113590) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 107-482aa; Full Length of Mature Protein. The amino acid sequence is listed below: YRLFPGEPKW KKNILTYRIS KYTPSMSPTE VDKAIQMALH AWSTAVPLNF VRINSGEADI MISFETGDHG DSYPFDGPRG TLAHAFAPGE GLGGDTHFDN AEKWTMGTNG FNLFTVAAHE FGHALGLGHS TDPSALMYPT YKYQNPYRFH LPKDDVKGIQ ALYGPRKIFP GKPTMPHIPP HKPSIPDLCD SSSSFDAVTM LGKELLFFKD RIFWRRQVHL PTGIRPSTIT SSFPQLMSNV DAAYEVAERG IAFFFKGPHY WVTRGFHMQG PPRTIYDFGF PRHVQRIDAA VYLKEPQKTL FFVGEEYYSY DERKKKMEKD YPKNTEEEFS GVSGHIDAAV ELNGYIYFFS GRKTFKYDTE KEDVVSVVKS SSWIGC. It is sometimes possible for the material contained within the vial of "Matrix metalloproteinase-20 (Mmp20), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.