Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25300_WB7.jpg WB (Western Blot) (ACBD3 monoclonal antibody. Western Blot analysis of ACBD3 expression in PC-12.)

Mouse ACBD3 Monoclonal Antibody | anti-ACBD3 antibody

ACBD3 (Golgi Resident Protein GCP60, Acyl-CoA-binding Domain-containing Protein 3, Golgi Complex-associated Protein 1, GOCAP1, Golgi Phosphoprotein 1, GOLPH1, PBR- and PKA-associated Protein 7, Peripheral Benzodiazepine Receptor-associated Protein PAP7, G

Average rating 0.0
No ratings yet
Gene Names
ACBD3; PAP7; GCP60; GOCAP1; GOLPH1
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ACBD3, Antibody; ACBD3 (Golgi Resident Protein GCP60, Acyl-CoA-binding Domain-containing Protein 3, Golgi Complex-associated Protein 1, GOCAP1, Golgi Phosphoprotein 1, GOLPH1, PBR- and PKA-associated Protein 7, Peripheral Benzodiazepine Receptor-associated Protein PAP7, G; anti-ACBD3 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G2
Specificity
Recognizes human ACBD3. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-ACBD3 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa73-172 from human ACBD3 (NP_073572) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(ACBD3 monoclonal antibody. Western Blot analysis of ACBD3 expression in PC-12.)

product-image-AAA25300_WB7.jpg WB (Western Blot) (ACBD3 monoclonal antibody. Western Blot analysis of ACBD3 expression in PC-12.)

WB (Western Blot)

(ACBD3 monoclonal antibody, Western Blot analysis of ACBD3 expression in HeLa.)

product-image-AAA25300_WB6.jpg WB (Western Blot) (ACBD3 monoclonal antibody, Western Blot analysis of ACBD3 expression in HeLa.)

Application Data

(Detection limit for recombinant GST tagged ACBD3 is ~0.1ng/ml as a capture antibody.)

product-image-AAA25300_APP5.jpg Application Data (Detection limit for recombinant GST tagged ACBD3 is ~0.1ng/ml as a capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to ACBD3 on HeLa cell. [antibody concentration 10ug/ml].)

product-image-AAA25300_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to ACBD3 on HeLa cell. [antibody concentration 10ug/ml].)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to ACBD3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)

product-image-AAA25300_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to ACBD3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].)

WB (Western Blot)

(Western Blot analysis of ACBD3 expression in transfected 293T cell line by ACBD3 monoclonal antibody. Lane 1: ACBD3 transfected lysate (60.6kD). Lane 2: Non-transfected lysate.)

product-image-AAA25300_WB2.jpg WB (Western Blot) (Western Blot analysis of ACBD3 expression in transfected 293T cell line by ACBD3 monoclonal antibody. Lane 1: ACBD3 transfected lysate (60.6kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (37kD).)

product-image-AAA25300_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (37kD).)
Product Categories/Family for anti-ACBD3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
Golgi resident protein GCP60
NCBI Official Synonym Full Names
acyl-CoA binding domain containing 3
NCBI Official Symbol
ACBD3
NCBI Official Synonym Symbols
PAP7; GCP60; GOCAP1; GOLPH1
NCBI Protein Information
Golgi resident protein GCP60
UniProt Protein Name
Golgi resident protein GCP60
UniProt Gene Name
ACBD3
UniProt Synonym Gene Names
GCP60; GOCAP1; GOLPH1; GOCAP1; GOLPH1
UniProt Entry Name
GCP60_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ACBD3 acbd3 (Catalog #AAA25300) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ACBD3 (Golgi Resident Protein GCP60, Acyl-CoA-binding Domain-containing Protein 3, Golgi Complex-associated Protein 1, GOCAP1, Golgi Phosphoprotein 1, GOLPH1, PBR- and PKA-associated Protein 7, Peripheral Benzodiazepine Receptor-associated Protein PAP7, G reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACBD3 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACBD3 acbd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACBD3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.