Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26124_IF6.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to ACBD3 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse ACBD3 Monoclonal Antibody | anti-ACBD3 antibody

ACBD3 (Acyl-Coenzyme A Binding Domain Containing 3, GCP60, GOCAP1, GOLPH1, PAP7) (APC)

Average rating 0.0
No ratings yet
Gene Names
ACBD3; PAP7; GCP60; GOCAP1; GOLPH1
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
ACBD3, Antibody; ACBD3 (Acyl-Coenzyme A Binding Domain Containing 3, GCP60, GOCAP1, GOLPH1, PAP7) (APC); Acyl-Coenzyme A Binding Domain Containing 3; GCP60; GOCAP1; GOLPH1; PAP7; anti-ACBD3 antibody
Ordering
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2H2
Specificity
Recognizes ACBD3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ACBD3 antibody
ELISA, IF (Immunofluorescence), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ACBD3 (NP_073572, 73aa-171aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to ACBD3 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26124_IF6.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to ACBD3 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to ACBD3 on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26124_IF5.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to ACBD3 on HeLa cell. [antibody concentration 10 ug/ml])

WB (Western Blot)

(ACBD3 monoclonal antibody (M02), clone 2H2. Western Blot analysis of ACBD3 expression in Raw 264.7.)

product-image-AAA26124_WB4.jpg WB (Western Blot) (ACBD3 monoclonal antibody (M02), clone 2H2. Western Blot analysis of ACBD3 expression in Raw 264.7.)

WB (Western Blot)

(ACBD3 monoclonal antibody (M02), clone 2H2. Western Blot analysis of ACBD3 expression in PC-12.)

product-image-AAA26124_WB3.jpg WB (Western Blot) (ACBD3 monoclonal antibody (M02), clone 2H2. Western Blot analysis of ACBD3 expression in PC-12.)

WB (Western Blot)

(ACBD3 monoclonal antibody (M02), clone 2H2. Western Blot analysis of ACBD3 expression in NIH/3T3.)

product-image-AAA26124_WB2.jpg WB (Western Blot) (ACBD3 monoclonal antibody (M02), clone 2H2. Western Blot analysis of ACBD3 expression in NIH/3T3.)

WB (Western Blot)

(ACBD3 monoclonal antibody (M02), clone 2H2. Western Blot analysis of ACBD3 expression in A-431.)

product-image-AAA26124_WB.jpg WB (Western Blot) (ACBD3 monoclonal antibody (M02), clone 2H2. Western Blot analysis of ACBD3 expression in A-431.)
Related Product Information for anti-ACBD3 antibody
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq]
Product Categories/Family for anti-ACBD3 antibody
References
1. Eukaryotic protein recruitment into the Chlamydia inclusion: implications for survival and growth. Soupene E, Rothschild J, Kuypers FA, Dean D.PLoS One. 2012;7(5):e36843. Epub 2012 May 9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
Golgi resident protein GCP60
NCBI Official Synonym Full Names
acyl-CoA binding domain containing 3
NCBI Official Symbol
ACBD3
NCBI Official Synonym Symbols
PAP7; GCP60; GOCAP1; GOLPH1
NCBI Protein Information
Golgi resident protein GCP60
UniProt Protein Name
Golgi resident protein GCP60
UniProt Gene Name
ACBD3
UniProt Synonym Gene Names
GCP60; GOCAP1; GOLPH1; GOCAP1; GOLPH1
UniProt Entry Name
GCP60_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ACBD3 acbd3 (Catalog #AAA26124) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ACBD3 can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ACBD3 acbd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ACBD3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.