Mouse ACBD3 Monoclonal Antibody | anti-ACBD3 antibody

ACBD3 (Acyl-Coenzyme A Binding Domain Containing 3, GCP60, GOCAP1, GOLPH1, PAP7) (FITC)

Cat. Num. AAA26390

• Gene Names: ACBD3; PAP7; GCP60; GOCAP1; GOLPH1
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: ACBD3, Antibody; ACBD3 (Acyl-Coenzyme A Binding Domain Containing 3, GCP60, GOCAP1, GOLPH1, PAP7) (FITC); Acyl-Coenzyme A Binding Domain Containing 3; GCP60; GOCAP1; GOLPH1; PAP7; anti-ACBD3 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2H2
• Specificity: Recognizes ACBD3.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-ACBD3 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ACBD3 (NP_073572, 73aa-171aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to ACBD3 on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to ACBD3 on HeLa cell. [antibody concentration 10 ug/ml])

WB (Western Blot)

(ACBD3 monoclonal antibody (M02), clone 2H2. Western Blot analysis of ACBD3 expression in Raw 264.7 (Cat # L024V1).)

WB (Western Blot)

(ACBD3 monoclonal antibody (M02), clone 2H2. Western Blot analysis of ACBD3 expression in PC-12 (Cat # L012V1).)

WB (Western Blot)

(ACBD3 monoclonal antibody (M02), clone 2H2. Western Blot analysis of ACBD3 expression in NIH/3T3 (Cat # L018V1).)

WB (Western Blot)

(ACBD3 monoclonal antibody (M02), clone 2H2. Western Blot analysis of ACBD3 expression in A-431 (Cat # L015V1).)

Related Product Information for anti-ACBD3 antibody

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation. [provided by RefSeq]

Product Categories/Family for anti-ACBD3 antibody

Antibodies; Cell Markers

References

1. Eukaryotic protein recruitment into the Chlamydia inclusion: implications for survival and growth. Soupene E, Rothschild J, Kuypers FA, Dean D.PLoS One. 2012;7(5):e36843. Epub 2012 May 9.

NCBI and Uniprot Product Information

• NCBI GI #: 15826852
• NCBI GeneID: 64746
• NCBI Accession #: NP_073572
• NCBI GenBank Nucleotide #: NM_022735
• UniProt Accession #: Q9H3P7
• Molecular Weight: 60kDa
• NCBI Official Full Name: Golgi resident protein GCP60
• NCBI Official Synonym Full Names: acyl-CoA binding domain containing 3
• NCBI Official Symbol: ACBD3
• NCBI Official Synonym Symbols: PAP7; GCP60; GOCAP1; GOLPH1
• NCBI Protein Information: Golgi resident protein GCP60
• UniProt Protein Name: Golgi resident protein GCP60
• UniProt Gene Name: ACBD3
• UniProt Synonym Gene Names: GCP60; GOCAP1; GOLPH1; GOCAP1; GOLPH1
• UniProt Entry Name: GCP60_HUMAN