Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA24721_WB6.jpg WB (Western Blot) (AKAP8 monoclonal antibody (Western Blot analysis of AKAP8 expression in HeLa NE)

Mouse anti-Human AKAP8 Monoclonal Antibody | anti-AKAP8 antibody

AKAP8 (A-kinase Anchor Protein 8, AKAP-8, A-kinase Anchor Protein 95kD, AKAP 95, AKAP95, DKFZp586B1222) (Biotin)

Gene Names
AKAP8; AKAP-8; AKAP95; AKAP 95; AKAP-95
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AKAP8, Antibody; AKAP8 (A-kinase Anchor Protein 8, AKAP-8, A-kinase Anchor Protein 95kD, AKAP 95, AKAP95, DKFZp586B1222) (Biotin); anti-AKAP8 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D4
Specificity
Recognizes human AKAP8.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-AKAP8 antibody
ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa551-662 from AKAP8 (NP_005849) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VDPEMEGDDNLGGEDKKETPEEVAADVLAEVITAAVRAVDGEGAPAPESSGEPAEDEGPTDTAEAGSDPQAEQLLEEQVPCGTAHEKGVPKARSEAAEAGNGAETMAAEAES
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(AKAP8 monoclonal antibody (Western Blot analysis of AKAP8 expression in HeLa NE)

product-image-AAA24721_WB6.jpg WB (Western Blot) (AKAP8 monoclonal antibody (Western Blot analysis of AKAP8 expression in HeLa NE)

IP (Immunoprecipitation)

(Immunoprecipitation of AKAP8 transfected lysate using AKAP8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AKAP8 monoclonal antibody.)

product-image-AAA24721_IP5.jpg IP (Immunoprecipitation) (Immunoprecipitation of AKAP8 transfected lysate using AKAP8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with AKAP8 monoclonal antibody.)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to AKAP8 on HeLa cell. [antibody concentration 10ug/ml])

product-image-AAA24721_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to AKAP8 on HeLa cell. [antibody concentration 10ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to AKAP8 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml])

product-image-AAA24721_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to AKAP8 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml])

WB (Western Blot)

(Western Blot analysis of AKAP8 expression in transfected 293T cell line by AKAP8 monoclonal antibody Lane 1: AKAP8 transfected lysate (76.2kD). Lane 2: Non-transfected lysate.)

product-image-AAA24721_WB2.jpg WB (Western Blot) (Western Blot analysis of AKAP8 expression in transfected 293T cell line by AKAP8 monoclonal antibody Lane 1: AKAP8 transfected lysate (76.2kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(Western Blot detection against Immunogen (38.43kD).)

product-image-AAA24721_WB.jpg WB (Western Blot) (Western Blot detection against Immunogen (38.43kD).)
Product Categories/Family for anti-AKAP8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
A-kinase anchor protein 8
NCBI Official Synonym Full Names
A-kinase anchoring protein 8
NCBI Official Symbol
AKAP8
NCBI Official Synonym Symbols
AKAP-8; AKAP95; AKAP 95; AKAP-95
NCBI Protein Information
A-kinase anchor protein 8
UniProt Protein Name
A-kinase anchor protein 8
UniProt Gene Name
AKAP8
UniProt Synonym Gene Names
AKAP95; AKAP-8; AKAP 95
UniProt Entry Name
AKAP8_HUMAN

Similar Products

Product Notes

The AKAP8 akap8 (Catalog #AAA24721) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AKAP8 (A-kinase Anchor Protein 8, AKAP-8, A-kinase Anchor Protein 95kD, AKAP 95, AKAP95, DKFZp586B1222) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AKAP8 can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), IP (Immunoprecipitation), WB (Western Blot). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKAP8 akap8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKAP8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.