Mouse anti-Human AKR1B10 Monoclonal Antibody | anti-AKR1B10 antibody
AKR1B10 (Aldo-keto Reductase Family 1 Member B10, ARL-1, Aldose Reductase-like, Aldose Reductase-related Protein, ARP, hARP, Small Intestine Reductase, SI Reductase, AKR1B11) APC
Gene Names
                                                    AKR1B10; HIS; HSI; ARL1; ARL-1; ALDRLn; AKR1B11; AKR1B12
                                                Reactivity
                                                    Human
                                                Applications
                                                    ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
                                                Purity
                                                    Purified by Protein A Affinity Chromatography.
                                                Synonyms
                                            AKR1B10, Antibody; AKR1B10 (Aldo-keto Reductase Family 1 Member B10, ARL-1, Aldose Reductase-like, Aldose Reductase-related Protein, ARP, hARP, Small Intestine Reductase, SI Reductase, AKR1B11) APC; anti-AKR1B10 antibody
                                        
                    Host                
                
                    Mouse                
            
                    Reactivity                
                
                    Human                
            
                    Clonality                
                
                    Monoclonal                
            
                    Isotype                
                
                    IgG2a,k                
            
                    Clone Number                
                
                    1A6                
            
                    Specificity                
                
                    Recognizes human AKR1B10.                
            
                    Purity/Purification                
                
                    Purified by Protein A Affinity Chromatography.                
            
                    Form/Format                
                
                    Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).                
            
                    Applicable Applications for anti-AKR1B10 antibody                
                
                    ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)                
            
                    Application Notes                
                
                    IF: 10ug/ml
Applications are based on unconjugated antibody.
            Applications are based on unconjugated antibody.
                        Immunogen                    
                    
                        Partial recombinant corresponding to aa76-144 from human AKR1B10 (NP_064695) with GST tag. MW of the GST tag alone is 26kD.                    
                
                        Immunogen Sequence                    
                    
                        VSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWE                    
                
                        Conjugate                    
                    
                        APC                    
                
                    Preparation and Storage                
                
                    Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.                
            
                    Product Categories/Family for anti-AKR1B10 antibody                
                
            NCBI and Uniprot Product Information
                    NCBI GI #                
                
            
                    NCBI GeneID                
                
            
                    NCBI Accession #                
                
            
                    NCBI GenBank Nucleotide #                
                
            
                    Molecular Weight                
                
                                            36 kDa (316aa), confirmed by MALDI-TOF.                                    
            
                    NCBI Official Full Name                
                
                    aldo-keto reductase family 1 member B10                
            
                    NCBI Official Synonym Full Names                
                
                    aldo-keto reductase family 1 member B10                
            
                    NCBI Official Symbol                
                
                    AKR1B10                 
            
                    NCBI Official Synonym Symbols                
                
                    HIS; HSI; ARL1; ARL-1; ALDRLn; AKR1B11; AKR1B12                 
            
                    NCBI Protein Information                
                
                    aldo-keto reductase family 1 member B10                
            
                    UniProt Protein Name                
                
                    Aldo-keto reductase family 1 member B10                
            
                    UniProt Gene Name                
                
                    AKR1B10                
            
                    UniProt Synonym Gene Names                
                
                    AKR1B11; ARP; hARP                
            
                    UniProt Entry Name                
                
                    AK1BA_HUMAN                
            Similar Products
Product Notes
The AKR1B10 akr1b10 (Catalog #AAA24427) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AKR1B10 (Aldo-keto Reductase Family 1 Member B10, ARL-1, Aldose Reductase-like, Aldose Reductase-related Protein, ARP, hARP, Small Intestine Reductase, SI Reductase, AKR1B11) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AKR1B10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AKR1B10 akr1b10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AKR1B10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.

 
                                                         
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                 
                                                