Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA47863_AD13.jpg Application Data (Detection of Ataxin-1 in Neuroblastoma cell line SK-N-BE at 10ug/ml: DAPI (blue) nuclear stain, Texas Red F actin stain, FITC (green) Ataxin-1 stain.)

Mouse Ataxin-1 Monoclonal Antibody | anti-Atxn1 antibody

Ataxin-1 Monoclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
Atxn1; Atx1; Sca1; C85907; Gm10786; 2900016G23Rik
Applications
Immunofluorescence, Immunoblot, Western Blot
Synonyms
Ataxin-1, Antibody; Ataxin-1 Monoclonal Antibody; anti-Atxn1 antibody
Ordering
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b
Specificity
This antibody recognizes human, mouse, and rat Ataxin-1.
Form/Format
100ug (1mg/ml) Protein G-purified antibody in PBS, pH 7.4, 0.1% sodium azide, 50% glycerol.
Sequence Length
791
Applicable Applications for anti-Atxn1 antibody
IF (Immunofluorescence), IB (Immunoblot)
Immunogen
Synthetic peptide corresponding to aa 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. This sequence is 100% identical to rat and 88% identical to human Ataxin-1.

Application Data

(Detection of Ataxin-1 in Neuroblastoma cell line SK-N-BE at 10ug/ml: DAPI (blue) nuclear stain, Texas Red F actin stain, FITC (green) Ataxin-1 stain.)

product-image-AAA47863_AD13.jpg Application Data (Detection of Ataxin-1 in Neuroblastoma cell line SK-N-BE at 10ug/ml: DAPI (blue) nuclear stain, Texas Red F actin stain, FITC (green) Ataxin-1 stain.)

Application Data

(Detection of Ataxin-1 in COS-1 cells transfected with Ataxin-1 at 5ug/ml.)

product-image-AAA47863_AD15.jpg Application Data (Detection of Ataxin-1 in COS-1 cells transfected with Ataxin-1 at 5ug/ml.)
Related Product Information for anti-Atxn1 antibody
Ataxin-1 is a member of the ATXN1 protein family. It is a neurodegenerative disorder protein that is believed to play a role in metabolism of RNA. A mutation of Ataxin-1 causes spinocerebellar ataxia type-1 (SCA1), a progressive neurodegenerative disease that primarily affects Purjinke cells in the brain stem and cerebellum. Ataxin-1 is ubiquitously expressed except in brain where it is limited to populations of neurons.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83,793 Da
NCBI Official Full Name
ataxin-1 isoform b
NCBI Official Synonym Full Names
ataxin 1
NCBI Official Symbol
Atxn1
NCBI Official Synonym Symbols
Atx1; Sca1; C85907; Gm10786; 2900016G23Rik
NCBI Protein Information
ataxin-1
UniProt Protein Name
Ataxin-1
UniProt Gene Name
Atxn1
UniProt Synonym Gene Names
Sca1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Atxn1 atxn1 (Catalog #AAA47863) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Ataxin-1 can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IB (Immunoblot). Researchers should empirically determine the suitability of the Atxn1 atxn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Ataxin-1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.