IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human liver cancer using ATP1B3 Rabbit mAb (AAA282773) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)
Rabbit anti-Human ATP1B3 Monoclonal Antibody | anti-ATP1B3 antibody
ATP1B3 Rabbit mAb
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
ATP1B3, Antibody; ATP1B3 Rabbit mAb; CD298; ATPB-3; ATP1B3; anti-ATP1B3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
GLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Applicable Applications for anti-ATP1B3 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 180-279 of human ATP1B3 (P54709).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human liver cancer using ATP1B3 Rabbit mAb (AAA282773) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human liver cancer using ATP1B3 Rabbit mAb (AAA282773) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of various lysates using ATP1B3 Rabbit mAb (AAA282773) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
WB (Western Blot)
(Western blot analysis of various lysates using ATP1B3 Rabbit mAb (AAA282773) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 60s.)
Related Product Information for anti-ATP1B3 antibody
The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2.
Product Categories/Family for anti-ATP1B3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 22kDa/32kDa
Observed MW: 32-45kDa
Observed MW: 32-45kDa
UniProt Protein Name
Sodium/potassium-transporting ATPase subunit beta-3
UniProt Gene Name
ATP1B3
UniProt Synonym Gene Names
ATPB-3
UniProt Entry Name
AT1B3_HUMAN
Similar Products
Product Notes
The ATP1B3 atp1b3 (Catalog #AAA282773) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP1B3 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP1B3 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ATP1B3 atp1b3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GLKPEGVPRI DCVSKNEDIP NVAVYPHNGM IDLKYFPYYG KKLHVGYLQP LVAVQVSFAP NNTGKEVTVE CKIDGSANLK SQDDRDKFLG RVMFKITARA. It is sometimes possible for the material contained within the vial of "ATP1B3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.