Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28451_IP12.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 600 ug extracts of Mouse heart using 3 ug ATP5A1 antibody (AAA28451). Western blot was performed from the immunoprecipitate using ATP5A1 antibody (AAA28451) at a dilution of 1:1000.)

Rabbit anti-Human ATP5A1 Monoclonal Antibody | anti-ATP5F1A antibody

ATP5A1 Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA
Purity
Affinity purification
Synonyms
ATP5A1, Antibody; ATP5A1 Rabbit mAb; OMR; ORM; ATPM; MOM2; ATP5A; hATP1; ATP5A1; MC5DN4; ATP5AL2; COXPD22; HEL-S-123m; anti-ATP5F1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
VPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
Applicable Applications for anti-ATP5F1A antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA
Application Notes
WB: 1:1000-1:6000
IHC-P: 1:200-1:2000
IF/ICC: 1:200-1:2000
IP: 0.5ug-4ug antibody for 400ug-600ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATP5A1 (P25705).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 600 ug extracts of Mouse heart using 3 ug ATP5A1 antibody (AAA28451). Western blot was performed from the immunoprecipitate using ATP5A1 antibody (AAA28451) at a dilution of 1:1000.)

product-image-AAA28451_IP12.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 600 ug extracts of Mouse heart using 3 ug ATP5A1 antibody (AAA28451). Western blot was performed from the immunoprecipitate using ATP5A1 antibody (AAA28451) at a dilution of 1:1000.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using ATP5A1 Rabbit mAb (AAA28451) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA28451_IHC11.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using ATP5A1 Rabbit mAb (AAA28451) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using ATP5A1 Rabbit mAb (AAA28451) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA28451_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using ATP5A1 Rabbit mAb (AAA28451) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using ATP5A1 Rabbit mAb (AAA28451) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA28451_IHC9.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using ATP5A1 Rabbit mAb (AAA28451) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using ATP5A1 Rabbit mAb (AAA28451) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA28451_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using ATP5A1 Rabbit mAb (AAA28451) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using ATP5A1 Rabbit mAb (AAA28451) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA28451_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using ATP5A1 Rabbit mAb (AAA28451) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using ATP5A1 Rabbit mAb (AAA28451) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

product-image-AAA28451_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using ATP5A1 Rabbit mAb (AAA28451) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.)

ICC (Immunocytochemistry)

(Confocal imaging of HeLa cells using ATP5A1 Rabbit mAb (AAA28451, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

product-image-AAA28451_ICC5.jpg ICC (Immunocytochemistry) (Confocal imaging of HeLa cells using ATP5A1 Rabbit mAb (AAA28451, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Mouse brain tissue using ATP5A1 Rabbit mAb (AAA28451, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

product-image-AAA28451_ICC4.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Mouse brain tissue using ATP5A1 Rabbit mAb (AAA28451, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

ICC (Immunocytochemistry)

(Confocal imaging of paraffin-embedded Rat brain tissue using ATP5A1 Rabbit mAb (AAA28451, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

product-image-AAA28451_ICC3.jpg ICC (Immunocytochemistry) (Confocal imaging of paraffin-embedded Rat brain tissue using ATP5A1 Rabbit mAb (AAA28451, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.)

ICC (Immunocytochemistry)

(Confocal imaging of NIH/3T3 cells using ATP5A1 Rabbit mAb (AAA28451, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

product-image-AAA28451_ICC2.jpg ICC (Immunocytochemistry) (Confocal imaging of NIH/3T3 cells using ATP5A1 Rabbit mAb (AAA28451, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.)

WB (Western Blot)

(Western blot analysis of various lysates using ATP5A1 Rabbit mAb (AAA28451) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

product-image-AAA28451_WB.jpg WB (Western Blot) (Western blot analysis of various lysates using ATP5A1 Rabbit mAb (AAA28451) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-ATP5F1A antibody
This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, using an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the alpha subunit of the catalytic core. Alternatively spliced transcript variants encoding the different isoforms have been identified. Pseudogenes of this gene are located on chromosomes 9, 2, and 16.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
498
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 60kDa
Observed MW: 55kDa
UniProt Protein Name
ATP synthase subunit alpha, mitochondrial
UniProt Gene Name
ATP5A1
UniProt Synonym Gene Names
ATP5A; ATP5AL2; ATPM
UniProt Entry Name
ATPA_HUMAN

Similar Products

Product Notes

The ATP5F1A atp5a1 (Catalog #AAA28451) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP5A1 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP5A1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA. WB: 1:1000-1:6000 IHC-P: 1:200-1:2000 IF/ICC: 1:200-1:2000 IP: 0.5ug-4ug antibody for 400ug-600ug extracts of whole cells ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the ATP5F1A atp5a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VPIGRGQREL IIGDRQTGKT SIAIDTIINQ KRFNDGSDEK KKLYCIYVAI GQKRSTVAQL VKRLTDADAM KYTIVVSATA SDAAPLQYLA PYSGCSMGEY F. It is sometimes possible for the material contained within the vial of "ATP5A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.