Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282835_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of PC-3 cells using 3 ug BCL2L12 antibody (AAA282835). Western blot was performed from the immunoprecipitate using BCL2L12 antibody (AAA282835) at a dilution of 1:500.)

Rabbit anti-Human BCL2L12 Monoclonal Antibody | anti-BCL2L12 antibody

BCL2L12 Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
BCL2L12, Antibody; BCL2L12 Rabbit mAb; anti-BCL2L12 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
GPPSTEKEAILRRLVALLEEEAEVINQKLASDPALRSKLVRLSSDSFARLVELFCSRDDSSRPSRACPGPPPPSPEPLARLALAMELSRRVAGLGGTLAGL
Applicable Applications for anti-BCL2L12 antibody
ELISA, IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human BCL2L12 (Q9HB09).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ug extracts of PC-3 cells using 3 ug BCL2L12 antibody (AAA282835). Western blot was performed from the immunoprecipitate using BCL2L12 antibody (AAA282835) at a dilution of 1:500.)

product-image-AAA282835_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ug extracts of PC-3 cells using 3 ug BCL2L12 antibody (AAA282835). Western blot was performed from the immunoprecipitate using BCL2L12 antibody (AAA282835) at a dilution of 1:500.)

IHC (Immunohiostchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using BCL2L12 Rabbit mAb (AAA282835) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

product-image-AAA282835_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using BCL2L12 Rabbit mAb (AAA282835) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using BCL2L12 Rabbit mAb (AAA282835) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)

product-image-AAA282835_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates using BCL2L12 Rabbit mAb (AAA282835) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.)
Related Product Information for anti-BCL2L12 antibody
This gene encodes a member of a family of proteins containing a Bcl-2 homology domain 2 (BH2). The encoded protein is an anti-apoptotic factor that acts as an inhibitor of caspases 3 and 7 in the cytoplasm. In the nucleus, it binds to the p53 tumor suppressor protein, preventing its association with target genes. Overexpression of this gene has been detected in a number of different cancers. There is a pseudogene for this gene on chromosome 3. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 37kDa
Observed MW: 32kDa
UniProt Protein Name
Bcl-2-like protein 12
UniProt Gene Name
BCL2L12
UniProt Synonym Gene Names
BPR; Bcl2-L-12
UniProt Entry Name
B2L12_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The BCL2L12 bcl2l12 (Catalog #AAA282835) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCL2L12 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BCL2L12 can be used in a range of immunoassay formats including, but not limited to, ELISA, IP (Immunoprecipitation), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the BCL2L12 bcl2l12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GPPSTEKEAI LRRLVALLEE EAEVINQKLA SDPALRSKLV RLSSDSFARL VELFCSRDDS SRPSRACPGP PPPSPEPLAR LALAMELSRR VAGLGGTLAG L. It is sometimes possible for the material contained within the vial of "BCL2L12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.