Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA25632_WB7.jpg WB (Western Blot) (CAPNS1 monoclonal antibody, Western Blot analysis of CAPNS1 expression in A-431.)

Mouse anti-Human, Rat CAPNS1 Monoclonal Antibody | anti-CAPNS1 antibody

CAPNS1 (Calpain Small Subunit 1, CSS1, Calcium-activated Neutral Proteinase Small Subunit, CANP Small Subunit, Calcium-dependent Protease Small Subunit, CDPS, Calcium-dependent Protease Small Subunit 1, Calpain Regulatory Subunit, CAPN4, CAPNS) (PE)

Average rating 0.0
No ratings yet
Gene Names
CAPNS1; CANP; CDPS; CSS1; CANPS; CAPN4; CALPAIN4
Reactivity
Human, Rat
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CAPNS1, Antibody; CAPNS1 (Calpain Small Subunit 1, CSS1, Calcium-activated Neutral Proteinase Small Subunit, CANP Small Subunit, Calcium-dependent Protease Small Subunit, CDPS, Calcium-dependent Protease Small Subunit 1, Calpain Regulatory Subunit, CAPN4, CAPNS) (PE); anti-CAPNS1 antibody
Ordering
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3C4
Specificity
Recognizes human CAPNS1. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CAPNS1 antibody
ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
IF: 20ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa172-260 from human CAPNS1 (AAH00592) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQE
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

WB (Western Blot)

(CAPNS1 monoclonal antibody, Western Blot analysis of CAPNS1 expression in A-431.)

product-image-AAA25632_WB7.jpg WB (Western Blot) (CAPNS1 monoclonal antibody, Western Blot analysis of CAPNS1 expression in A-431.)

WB (Western Blot)

(Western blot analysis of CAPNS1 over-expressed 293 cell line, cotransfected with CAPNS1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CAPNS1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

product-image-AAA25632_WB6.jpg WB (Western Blot) (Western blot analysis of CAPNS1 over-expressed 293 cell line, cotransfected with CAPNS1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CAPNS1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Application Data

(Detection limit for recombinant GST tagged CAPNS1 is ~0.1ng/ml when antibody 124328 was used as capture antibody.)

product-image-AAA25632_APP5.jpg Application Data (Detection limit for recombinant GST tagged CAPNS1 is ~0.1ng/ml when antibody 124328 was used as capture antibody.)

IF (Immunofluorescence)

(Immunofluorescence staining of CAPNS1 on HeLa cells using antibody 124328 at 20ug/ml.)

product-image-AAA25632_IF4.jpg IF (Immunofluorescence) (Immunofluorescence staining of CAPNS1 on HeLa cells using antibody 124328 at 20ug/ml.)

IHC (Immunohistochemistry)

(Immunoperoxidase staining of CAPNS1 on formalin-fixed paraffin-embedded human kidney using antibody 124328 at 3ug/ml.)

product-image-AAA25632_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase staining of CAPNS1 on formalin-fixed paraffin-embedded human kidney using antibody 124328 at 3ug/ml.)

WB (Western Blot)

(Western Blot analysis of CAPNS1 expression in transfected 293T cell line using antibody 124328: Lane 1: CAPNS1 transfected lysate (28.3kD) Lane 2: Non-transfected lysate)

product-image-AAA25632_WB2.jpg WB (Western Blot) (Western Blot analysis of CAPNS1 expression in transfected 293T cell line using antibody 124328: Lane 1: CAPNS1 transfected lysate (28.3kD) Lane 2: Non-transfected lysate)

WB (Western Blot)

(Western Blot analysis of CAPNS1 expression in PC-12 cells using antibody 124328.)

product-image-AAA25632_WB.jpg WB (Western Blot) (Western Blot analysis of CAPNS1 expression in PC-12 cells using antibody 124328.)
Product Categories/Family for anti-CAPNS1 antibody
References
1. Overexpression of a Minimal Domain of Calpastatin Suppresses IL-6 Production and Th17 Development via Reduced NF-kB and Increased STAT5 Signals. Iguchi-Hashimoto M, Usui T, Yoshifuji H, Shimizu M, Kobayashi S, Ito Y, Murakami K, Shiomi A, Yukawa N, Kawabata D, Nojima T, Ohmura K, Fujii T, Mimori T.PLoS One. 2011;6(10):e27020. Epub 2011 Oct 27. 2. The calpain inhibitor calpeptin prevents bleomycin-induced pulmonary fibrosis in mice. Tabata C, Tabata R, Nakano T.Clin Exp Immunol. 2010 Sep 15. doi: 10.1111/j.1365-2249.2010.04257.x. 3. Vitamin E and C supplementation does not ameliorate muscle dysfunction following anterior cruciate ligament surgery. Barker T, Leonard SW, Hansen J, Trawick RH, Ingram R, Burdett G, Lebold KM, Walker JA, Traber MG.Free Radic Biol Med. 2009 Sep 11.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
826
Molecular Weight
28,316 Da
NCBI Official Full Name
Homo sapiens calpain, small subunit 1, mRNA
NCBI Official Synonym Full Names
calpain small subunit 1
NCBI Official Symbol
CAPNS1
NCBI Official Synonym Symbols
CANP; CDPS; CSS1; CANPS; CAPN4; CALPAIN4
NCBI Protein Information
calpain small subunit 1

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CAPNS1 (Catalog #AAA25632) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CAPNS1 (Calpain Small Subunit 1, CSS1, Calcium-activated Neutral Proteinase Small Subunit, CANP Small Subunit, Calcium-dependent Protease Small Subunit, CDPS, Calcium-dependent Protease Small Subunit 1, Calpain Regulatory Subunit, CAPN4, CAPNS) (PE) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CAPNS1 can be used in a range of immunoassay formats including, but not limited to, ELISA, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). IF: 20ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CAPNS1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CAPNS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request Manual

Please complete the form below and a representative will contact you as soon as possible.

Request Quote

Please complete the form below and a representative will contact you as soon as possible.