Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282849_FCM13.jpg FCM/FACS (Flow Cytometry) (Flow cytometric analysis of CD28 Rabbit mAb Cocotail (10 ug/mL) in Jurkat cells (Orange) compare to Alexa Fluor 647 conjugated goat anti-rabbit pAb (1:600 dilution) Isotype control (Blue) and non-staining control (Red).)

Rabbit anti-Human CD28 Monoclonal Antibody | anti-CD28 antibody

CD28 Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Flow Cytometry, Functional Assay, Western Blot
Purity
Affinity purification
Synonyms
CD28, Antibody; CD28 Rabbit mAb; Tp44; CD28; anti-CD28 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Applicable Applications for anti-CD28 antibody
ELISA, FCM/FACS (Flow Cytometry), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant protein of human CD28 Full length (P10747).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

FCM/FACS (Flow Cytometry)

(Flow cytometric analysis of CD28 Rabbit mAb Cocotail (10 ug/mL) in Jurkat cells (Orange) compare to Alexa Fluor 647 conjugated goat anti-rabbit pAb (1:600 dilution) Isotype control (Blue) and non-staining control (Red).)

product-image-AAA282849_FCM13.jpg FCM/FACS (Flow Cytometry) (Flow cytometric analysis of CD28 Rabbit mAb Cocotail (10 ug/mL) in Jurkat cells (Orange) compare to Alexa Fluor 647 conjugated goat anti-rabbit pAb (1:600 dilution) Isotype control (Blue) and non-staining control (Red).)

WB (Western Blot)

(Western blot analysis of various lysates using CD28 Rabbit mAb (AAA282849) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA282849_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates using CD28 Rabbit mAb (AAA282849) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-CD28 antibody
The protein encoded by this gene is essential for T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
940
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 25kDa
Observed MW: 45kDa
UniProt Protein Name
T-cell-specific surface glycoprotein CD28
UniProt Gene Name
CD28
UniProt Entry Name
CD28_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CD28 cd28 (Catalog #AAA282849) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD28 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD28 can be used in a range of immunoassay formats including, but not limited to, ELISA, FCM/FACS (Flow Cytometry), WB (Western Blot). Researchers should empirically determine the suitability of the CD28 cd28 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLRLLLALNL FPSIQVTGNK ILVKQSPMLV AYDNAVNLSC KYSYNLFSRE FRASLHKGLD SAVEVCVVYG NYSQQLQVYS KTGFNCDGKL GNESVTFYLQ NLYVNQTDIY FCKIEVMYPP PYLDNEKSNG TIIHVKGKHL CPSPLFPGPS KPFWVLVVVG GVLACYSLLV TVAFIIFWVR SKRSRLLHSD YMNMTPRRPG PTRKHYQPYA PPRDFAAYRS. It is sometimes possible for the material contained within the vial of "CD28, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.