<
FCM/FACS (Flow Cytometry)
(Flow cytometry:1X10^6 Raji cells (negative control,left) and Jurkat cells (right) were intracellularly-stained with CD3H Rabbit mAb(AAA282622, 10 ug/mL,orange line) or Rabbit IgG isotype control (AC042, 10 ug/mL,blue line),followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).)
Rabbit anti-Human CD3H Monoclonal Antibody | anti-CD247 antibody
CD3H Rabbit mAb
Reactivity
Human
Applications
ELISA, Flow Cytometry, Functional Assay, Immunohistochemistry, Western Blot
Purity
Affinity purification
Synonyms
CD3H, Antibody; CD3H Rabbit mAb; T3Z; CD3H; CD3Q; CD3Z; TCRZ; IMD25; CD3ZETA; CD3-ZETA; anti-CD247 antibody
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
QQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Applicable Applications for anti-CD247 antibody
ELISA, FCM/FACS (Flow Cytometry), IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 65-164 of human CD3H (P20963).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
FCM/FACS (Flow Cytometry)
(Flow cytometry:1X10^6 Raji cells (negative control,left) and Jurkat cells (right) were intracellularly-stained with CD3H Rabbit mAb(AAA282622, 10 ug/mL,orange line) or Rabbit IgG isotype control (AC042, 10 ug/mL,blue line),followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).)
FCM/FACS (Flow Cytometry)
(Flow cytometry:1X10^6 Raji cells (negative control,left) and Jurkat cells (right) were intracellularly-stained with CD3H Rabbit mAb(AAA282622, 10 ug/mL,orange line) or Rabbit IgG isotype control (AC042, 10 ug/mL,blue line),followed by FITC conjugated goat anti-rabbit pAb(1:200 dilution) staining. Non-fluorescently stained cells were used as blank control (red line).)
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using CD3H Rabbit mAb (AAA282622) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)
IHC (Immunohistochemisry)
(Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using CD3H Rabbit mAb (AAA282622) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using CD3H Rabbit mAb (AAA282622) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)
IHC (Immunohiostchemistry)
(Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using CD3H Rabbit mAb (AAA282622) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.)
WB (Western Blot)
(Western blot analysis of lysates from Jurkat cells, using CD3H Rabbit mAb (AAA282622) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.)
WB (Western Blot)
(Western blot analysis of lysates from Jurkat cells, using CD3H Rabbit mAb (AAA282622) at 1?1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.)
Related Product Information for anti-CD247 antibody
The protein encoded by this gene is T-cell receptor zeta, which together with T-cell receptor alpha/beta and gamma/delta heterodimers, and with CD3-gamma, -delta and -epsilon, forms the T-cell receptor-CD3 complex. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Product Categories/Family for anti-CD247 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 19kDa
Observed MW: 16kDa
Observed MW: 16kDa
UniProt Protein Name
T-cell surface glycoprotein CD3 zeta chain
UniProt Gene Name
CD247
UniProt Synonym Gene Names
CD3Z; T3Z; TCRZ
UniProt Entry Name
CD3Z_HUMAN
Similar Products
Product Notes
The CD247 cd247 (Catalog #AAA282622) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD3H Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD3H can be used in a range of immunoassay formats including, but not limited to, ELISA, FCM/FACS (Flow Cytometry), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CD247 cd247 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QQGQNQLYNE LNLGRREEYD VLDKRRGRDP EMGGKPQRRK NPQEGLYNEL QKDKMAEAYS EIGMKGERRR GKGHDGLYQG LSTATKDTYD ALHMQALPPR. It is sometimes possible for the material contained within the vial of "CD3H, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.