Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA126871_FCM11.png FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of Raji cells using anti-CD45 antibody (AAA126871).Overlay histogram showing Raji cells stained with AAA126871 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-CD45 Antibody (AAA126871, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Mouse anti-Human CD45 Monoclonal Antibody | anti-PTPRC antibody

Anti-CD45 Antibody Picoband (monoclonal, 2H3)

Average rating 0.0
No ratings yet
Gene Names
PTPRC; LCA; LY5; B220; CD45; L-CA; T200; CD45R; GP180
Reactivity
Human
Applications
Flow Cytometry, Functional Assay, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
CD45, Antibody; Anti-CD45 Antibody Picoband (monoclonal, 2H3); anti-PTPRC antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
Mouse IgG2b
Clone Number
2H3
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.
Concentration
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml. (varies by lot)
Applicable Applications for anti-PTPRC antibody
FCM/FACS (Flow Cytometry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Reconstitution
Adding 0.2 ml of distilled water will yield a concentration of 500 ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CD45(1214-1254aa EQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVK), different from the related mouse sequence by eight amino acids, and from the related rat sequence by ten amino acids.
Preparation and Storage
Store at -20 degree C for one year from date of receipt. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for six months. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 3. Flow Cytometry analysis of Raji cells using anti-CD45 antibody (AAA126871).Overlay histogram showing Raji cells stained with AAA126871 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-CD45 Antibody (AAA126871, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA126871_FCM11.png FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of Raji cells using anti-CD45 antibody (AAA126871).Overlay histogram showing Raji cells stained with AAA126871 (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-CD45 Antibody (AAA126871, 1 ug/1x10^6 cells) for 30 min at 20 degree C. DyLight488 conjugated goat anti-mouse IgG was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was mouse IgG (1 ug/1x10^6) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

IF (Immunofluorescence)

(Figure 2. IF analysis of CD45 using anti-CD45 antibody (AAA126871).CD45 was detected in a paraffin-embedded section of human tonsli tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 5 ug/mL mouse anti-CD45 Antibody (AAA126871) overnight at 4 degree C. Biotin conjugated goat anti-mouse IgG (BA1001) was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using DyLight488 Conjugated Avidin (BA1128). The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

product-image-AAA126871_IF13.jpg IF (Immunofluorescence) (Figure 2. IF analysis of CD45 using anti-CD45 antibody (AAA126871).CD45 was detected in a paraffin-embedded section of human tonsli tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 5 ug/mL mouse anti-CD45 Antibody (AAA126871) overnight at 4 degree C. Biotin conjugated goat anti-mouse IgG (BA1001) was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using DyLight488 Conjugated Avidin (BA1128). The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.)

WB (Western Blot)

(Figure 1. Western blot analysis of CD45 using anti-CD45 antibody (AAA126871).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Jurkat whole cell lysates,Lane 2: human Raji whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-CD45 antigen affinity purified monoclonal antibody (#AAA126871) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CD45 at approximately 220 kDa. The expected band size for CD45 is at 220 kDa.)

product-image-AAA126871_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of CD45 using anti-CD45 antibody (AAA126871).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 ug of sample under reducing conditions.Lane 1: human Jurkat whole cell lysates,Lane 2: human Raji whole cell lysates.After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-CD45 antigen affinity purified monoclonal antibody (#AAA126871) at 0.5 ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CD45 at approximately 220 kDa. The expected band size for CD45 is at 220 kDa.)
Related Product Information for anti-PTPRC antibody
CD45 (Cluster of Differentiation 45), also known as PTPRC, LCA or CD45R, is an enzyme that, in humans, is encoded by the PTPRC gene. It is a member of the protein tyrosine phosphatase (PTP) family. CD45 is a major high molecular mass leukocyte cell surface molecule which is also an integral membrane protein tyrosine phosphatase. The cytogenetic location of CD45 is 1q31.3-q32.1. This gene is especially a prototype for transmembrane protein-tyrosine phosphatase (PTP). Targeted disruption of the CD45 gene leads to enhanced cytokine and interferon receptor-mediated activation of JAKs and STAT proteins. In vitro, CD45 directly dephosphorylates and binds to JAKs. Functionally, CD45 negatively regulates interleukin-3-mediated cellular proliferation, erythropoietin-dependent hematopoiesis, and antiviral responses in vitro and in vivo. In addition, CD45 has been best studied in T cells, where it determines T cell receptor signaling thresholds. CD45 is moved into or out of the immunological synapse (IS) membrane microdomain depending on the relative influence of interaction with the extracellular galectin lattice or the intracellular actin cytoskeleton. Galectin interaction can be finetuned by varying usage of the heavily Oglycosylated spliced regions and sialylation of Nlinked carbohydrates.
Product Categories/Family for anti-PTPRC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
147,254 Da
NCBI Official Full Name
receptor-type tyrosine-protein phosphatase C isoform 1
NCBI Official Synonym Full Names
protein tyrosine phosphatase, receptor type, C
NCBI Official Symbol
PTPRC
NCBI Official Synonym Symbols
LCA; LY5; B220; CD45; L-CA; T200; CD45R; GP180
NCBI Protein Information
receptor-type tyrosine-protein phosphatase C; CD45 antigen; T200 glycoprotein; T200 leukocyte common antigen; protein tyrosine phosphatase, receptor type, c polypeptide
UniProt Protein Name
Receptor-type tyrosine-protein phosphatase C
UniProt Gene Name
PTPRC
UniProt Synonym Gene Names
CD45; L-CA
UniProt Entry Name
PTPRC_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The PTPRC ptprc (Catalog #AAA126871) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-CD45 Antibody Picoband (monoclonal, 2H3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD45 can be used in a range of immunoassay formats including, but not limited to, FCM/FACS (Flow Cytometry), IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the PTPRC ptprc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD45, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.