Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283023_FCM10.jpg FCM/FACS (Flow Cytometry) (Flow cytometry:1X10^6 C2C12 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070,2 ug/mL,left) or CD80 Rabbit mAb(AAA283023,2 ug/mL,right).)

Rabbit anti-Mouse CD80 Monoclonal Antibody | anti-Cd80 antibody

CD80 Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Mouse
Applications
ELISA, Flow Cytometry, Functional Assay, Western Blot
Purity
Affinity purification
Synonyms
CD80, Antibody; CD80 Rabbit mAb; B71; Ly53; TSA1; Cd28l; Ly-53; MIC17; CD80; anti-Cd80 antibody
Ordering
Host
Rabbit
Reactivity
Mouse
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
VDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSK
Applicable Applications for anti-Cd80 antibody
ELISA, FCM/FACS (Flow Cytometry), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 38-245 of mouse CD80(NP_033985.3)
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

FCM/FACS (Flow Cytometry)

(Flow cytometry:1X10^6 C2C12 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070,2 ug/mL,left) or CD80 Rabbit mAb(AAA283023,2 ug/mL,right).)

product-image-AAA283023_FCM10.jpg FCM/FACS (Flow Cytometry) (Flow cytometry:1X10^6 C2C12 cells were surface-stained with ABflo® 647 Rabbit IgG isotype control (A22070,2 ug/mL,left) or CD80 Rabbit mAb(AAA283023,2 ug/mL,right).)

FCM/FACS (Flow Cytometry)

(Flow cytometry:1X10^6 Neuro-2a cells(negative control,left) and C2C12 cells(right) were surface-stained with CD80 Rabbit mAb(AAA283023,2ug/mL,orange line) or ABflo® 647 Rabbit IgG isotype control (A22070,2ug/mL,blue line).Non-fluorescently stained cells was used as blank control (red line).)

product-image-AAA283023_FCM11.jpg FCM/FACS (Flow Cytometry) (Flow cytometry:1X10^6 Neuro-2a cells(negative control,left) and C2C12 cells(right) were surface-stained with CD80 Rabbit mAb(AAA283023,2ug/mL,orange line) or ABflo® 647 Rabbit IgG isotype control (A22070,2ug/mL,blue line).Non-fluorescently stained cells was used as blank control (red line).)

WB (Western Blot)

(Western blot analysis of various lysates, using CD80 Rabbit mAb (AAA283023) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA283023_WB13.jpg WB (Western Blot) (Western blot analysis of various lysates, using CD80 Rabbit mAb (AAA283023) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

WB (Western Blot)

(Western blot analysis of various lysates, using CD80 Rabbit mAb (AAA283023) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)

product-image-AAA283023_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates, using CD80 Rabbit mAb (AAA283023) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 45s.)
Related Product Information for anti-Cd80 antibody
Predicted to enable coreceptor activity. Acts upstream of or within T cell costimulation; cellular response to lipopolysaccharide; and positive regulation of alpha-beta T cell proliferation. Located in external side of plasma membrane. Is expressed in heart ventricle and skin. Human ortholog(s) of this gene implicated in type 1 diabetes mellitus. Orthologous to human CD80 (CD80 molecule).
Product Categories/Family for anti-Cd80 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 34kDa
Observed MW: 50-75kDa
UniProt Protein Name
T-lymphocyte activation antigen CD80
UniProt Gene Name
Cd80
UniProt Synonym Gene Names
B7; B7

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The Cd80 cd80 (Catalog #AAA283023) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD80 Rabbit mAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CD80 can be used in a range of immunoassay formats including, but not limited to, ELISA, FCM/FACS (Flow Cytometry), WB (Western Blot). Researchers should empirically determine the suitability of the Cd80 cd80 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VDEQLSKSVK DKVLLPCRYN SPHEDESEDR IYWQKHDKVV LSVIAGKLKV WPEYKNRTLY DNTTYSLIIL GLVLSDRGTY SCVVQKKERG TYEVKHLALV KLSIKADFST PNITESGNPS ADTKRITCFA SGGFPKPRFS WLENGRELPG INTTISQDPE SELYTISSQL DFNTTRNHTI KCLIKYGDAH VSEDFTWEKP PEDPPDSK. It is sometimes possible for the material contained within the vial of "CD80, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.