Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Have a question or looking for a specific datasheet Manual/COA/MSDS?
Submit a Question

Interested to get a quote about our products?
Request a Quote

WB (Western Blot) (Western blot analysis of CDC25C over-expressed 293 cell line, cotransfected with CDC25C Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDC25C monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Mouse anti-Human CDC25C Monoclonal Antibody | anti-CDC25C antibody

CDC25C (Cell Division Cycle 25 Homolog C, Cdc 25C, CDC 25, Dual Specificity Phosphatase Cdc25C, M-phase Inducer Phosphatase 3, MPIP3, PPP1R60) (Biotin)

Gene Names
CDC25C; CDC25; PPP1R60
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDC25C; Monoclonal Antibody; CDC25C (Cell Division Cycle 25 Homolog C; Cdc 25C; CDC 25; Dual Specificity Phosphatase Cdc25C; M-phase Inducer Phosphatase 3; MPIP3; PPP1R60) (Biotin); anti-CDC25C antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B11
Specificity
Recognizes human CDC25C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CDC25C antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 6ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa21-130 from human CDC25C (AAH19089) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCST
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western blot analysis of CDC25C over-expressed 293 cell line, cotransfected with CDC25C Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDC25C monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

WB (Western Blot) (Western blot analysis of CDC25C over-expressed 293 cell line, cotransfected with CDC25C Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CDC25C monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

IP (Immunoprecipitation)

(Immunoprecipitation of CDC25C transfected lysate using CDC25C monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CDC25C rabbit polyclonal antibody.)

IP (Immunoprecipitation) (Immunoprecipitation of CDC25C transfected lysate using CDC25C monoclonal antibody and Protein A Magnetic Bead and immunoblotted with CDC25C rabbit polyclonal antibody.)

Application Data

(Detection limit for recombinant GST tagged CDC25C is ~0.1ng/ml as a capture antibody.)

Application Data (Detection limit for recombinant GST tagged CDC25C is ~0.1ng/ml as a capture antibody.)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to CDC25C on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6ug/ml].)

IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to CDC25C on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 6ug/ml].)

WB (Western Blot)

(Western Blot analysis of CDC25C expression in transfected 293T cell line by CDC25C monoclonal antibody. Lane 1: CDC25C transfected lysate (53.312kD). Lane 2: Non-transfected lysate.)

WB (Western Blot) (Western Blot analysis of CDC25C expression in transfected 293T cell line by CDC25C monoclonal antibody. Lane 1: CDC25C transfected lysate (53.312kD). Lane 2: Non-transfected lysate.)

WB (Western Blot)

(CDC25C monoclonal antibody, Western Blot analysis of CDC25C expression in HeLa.)

WB (Western Blot) (CDC25C monoclonal antibody, Western Blot analysis of CDC25C expression in HeLa.)

WB (Western Blot)

(Western Blot detection against Immunogen (37.73kD).)

WB (Western Blot) (Western Blot detection against Immunogen (37.73kD).)
Product Categories/Family for anti-CDC25C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
995
Molecular Weight
45,608 Da
NCBI Official Full Name
Homo sapiens cell division cycle 25 homolog C (S. pombe), mRNA
NCBI Official Synonym Full Names
cell division cycle 25C
NCBI Official Symbol
CDC25C
NCBI Official Synonym Symbols
CDC25; PPP1R60
NCBI Protein Information
M-phase inducer phosphatase 3

Similar Products

Product Notes

The CDC25C (Catalog #AAA24754) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CDC25C (Cell Division Cycle 25 Homolog C, Cdc 25C, CDC 25, Dual Specificity Phosphatase Cdc25C, M-phase Inducer Phosphatase 3, MPIP3, PPP1R60) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDC25C can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 6ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDC25C for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDC25C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.