Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28457_IP6.jpg IP (Immunoprecipitation) (Immunoprecipitation of CDK1 from 300 µg extracts of 293T cells was performed using 3 µg of CDK1 Rabbit mAb (AAA28457). Rabbit IgG isotype control (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using CDK1 Rabbit mAb (AAA28457) at a dilution of 1:1000.)

Rabbit anti-Human CDK1 Monoclonal Antibody | anti-CDK1 antibody

CDK1 Rabbit mAb

Reactivity
Human
Applications
Western Blot, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA
Purity
Affinity purification
Synonyms
CDK1, Antibody; CDK1 Rabbit mAb; CDC2; CDC28A; P34CDC2; CDK1; anti-CDK1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
ATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Applicable Applications for anti-CDK1 antibody
WB (Western Blot), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA
Application Notes
WB: 1:1000-1:2000
IF/ICC: 1:50-1:200
IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 198-297 of human CDK1 (NP_001777.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation of CDK1 from 300 µg extracts of 293T cells was performed using 3 µg of CDK1 Rabbit mAb (AAA28457). Rabbit IgG isotype control (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using CDK1 Rabbit mAb (AAA28457) at a dilution of 1:1000.)

product-image-AAA28457_IP6.jpg IP (Immunoprecipitation) (Immunoprecipitation of CDK1 from 300 µg extracts of 293T cells was performed using 3 µg of CDK1 Rabbit mAb (AAA28457). Rabbit IgG isotype control (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1X reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using CDK1 Rabbit mAb (AAA28457) at a dilution of 1:1000.)

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using CDK1 Rabbit mAb (AAA28457) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28457_IF5.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using CDK1 Rabbit mAb (AAA28457) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using CDK1 Rabbit mAb (AAA28457) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28457_IF4.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using CDK1 Rabbit mAb (AAA28457) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using CDK1 Rabbit mAb (AAA28457) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28457_IF3.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using CDK1 Rabbit mAb (AAA28457) at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)(AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of lysates from Mouse spleen, using CDK1 Rabbit mAb (AAA28457) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

product-image-AAA28457_WB2.jpg WB (Western Blot) (Western blot analysis of lysates from Mouse spleen, using CDK1 Rabbit mAb (AAA28457) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.)

WB (Western Blot)

(Western blot analysis of various lysates using CDK1 Rabbit mAb (AAA28457) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

product-image-AAA28457_WB.jpg WB (Western Blot) (Western blot analysis of various lysates using CDK1 Rabbit mAb (AAA28457) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-CDK1 antibody
The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
983
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 34kDa
Observed MW: 34kDa
UniProt Protein Name
Cyclin-dependent kinase 1
UniProt Gene Name
CDK1
UniProt Synonym Gene Names
CDC2; CDC28A; CDKN1; P34CDC2; CDK1
UniProt Entry Name
CDK1_HUMAN

Similar Products

Product Notes

The CDK1 cdk1 (Catalog #AAA28457) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDK1 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDK1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA. WB: 1:1000-1:2000 IF/ICC: 1:50-1:200 IP: 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the CDK1 cdk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ATKKPLFHGD SEIDQLFRIF RALGTPNNEV WPEVESLQDY KNTFPKWKPG SLASHVKNLD ENGLDLLSKM LIYDPAKRIS GKMALNHPYF NDLDNQIKKM. It is sometimes possible for the material contained within the vial of "CDK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.