Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA283040_DB13.jpg DB (Dot Blot) (Dot-blot analysis of all sorts of peptides using Collagen IV Rabbit mAb antibody (AAA283040) at 1:1000 dilution.)

Rabbit anti-Human Collagen IV Monoclonal Antibody | anti-COL4A4/COL4A6/COL4A2/COL4A1 antibody

Collagen IV Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
ELISA, Dot Blot, Western Blot
Purity
Affinity purification
Synonyms
Collagen IV, Antibody; Collagen IV Rabbit mAb; BFH; ATS2; BFH1; CA44; Collagen IV; anti-COL4A4/COL4A6/COL4A2/COL4A1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
AQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGGGQALMSPGSCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKESQAQRQKISRCQVCVKYS
Applicable Applications for anti-COL4A4/COL4A6/COL4A2/COL4A1 antibody
ELISA, DB (Dot Blot), WB (Western Blot)
Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1573-1690 of human COL4A4 (NP_000083.3).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

DB (Dot Blot)

(Dot-blot analysis of all sorts of peptides using Collagen IV Rabbit mAb antibody (AAA283040) at 1:1000 dilution.)

product-image-AAA283040_DB13.jpg DB (Dot Blot) (Dot-blot analysis of all sorts of peptides using Collagen IV Rabbit mAb antibody (AAA283040) at 1:1000 dilution.)

WB (Western Blot)

(Western blot analysis of lysates from HeLa cells, using Collagen IV Rabbit mAb (AAA283040) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)

product-image-AAA283040_WB15.jpg WB (Western Blot) (Western blot analysis of lysates from HeLa cells, using Collagen IV Rabbit mAb (AAA283040) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Related Product Information for anti-COL4A4/COL4A6/COL4A2/COL4A1 antibody
This gene encodes one of the six subunits of type IV collagen, the major structural component of basement membranes. This particular collagen IV subunit, however, is only found in a subset of basement membranes. Like the other members of the type IV collagen gene family, this gene is organized in a head-to-head conformation with another type IV collagen gene so that each gene pair shares a common promoter. Mutations in this gene are associated with type II autosomal recessive Alport syndrome (hereditary glomerulonephropathy) and with familial benign hematuria (thin basement membrane disease). Two transcripts, differing only in their transcription start sites, have been identified for this gene and, as is common for collagen genes, multiple polyadenylation sites are found in the 3' UTR.
Product Categories/Family for anti-COL4A4/COL4A6/COL4A2/COL4A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 164kDa
Observed MW: 170-185kDa
UniProt Protein Name
Collagen alpha-4(IV) chain
UniProt Gene Name
COL4A4
UniProt Entry Name
CO4A4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The COL4A4/COL4A6/COL4A2/COL4A1 col4a4 (Catalog #AAA283040) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Collagen IV Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Collagen IV can be used in a range of immunoassay formats including, but not limited to, ELISA, DB (Dot Blot), WB (Western Blot). Researchers should empirically determine the suitability of the COL4A4/COL4A6/COL4A2/COL4A1 col4a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AQAVAVHSQD QSIPPCPQTW RSLWIGYSFL MHTGAGDQGG GQALMSPGSC LEDFRAAPFL ECQGRQGTCH FFANKYSFWL TTVKADLQFS SAPAPDTLKE SQAQRQKISR CQVCVKYS. It is sometimes possible for the material contained within the vial of "Collagen IV, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.