WB (Western Blot)
(Western blot analysis of extracts from various samples, using COX6C Mouse Monoclonal Antibody. Lane 1: Raji cells treated with blocking-peptides, Lane 2: Raji cells, Lane 3: mouse kidney tissue, Lane 4: rat liver tissue.)
Mouse COX6C Monoclonal Antibody | anti-COX6C antibody
COX6C Mouse Monoclonal Antibody
Reactivity
Human, Mouse, RatPrediction: Xenopus
Applications
ELISA, Western Blot
Purity
Affinity-chromatography.
Synonyms
COX6C, Antibody; COX6C Mouse Monoclonal Antibody; COX 6C; Cox6c; COX6C_HUMAN; Cytochrome c oxidase polypeptide VIc; Cytochrome c oxidase subunit 6C; cytochrome c oxidase subunit VIc; Cytochrome c oxidase subunit VIc preprotein; anti-COX6C antibody
Host
Mouse
Reactivity
Human, Mouse, Rat
Prediction: Xenopus
Prediction: Xenopus
Clonality
Monoclonal
Isotype
Mouse IgG1
Specificity
COX6C Antibody detects endogenous levels of total COX6C.
Purity/Purification
Affinity-chromatography.
Form/Format
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Sequence
MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
Applicable Applications for anti-COX6C antibody
ELISA, WB (Western Blot)
Immunogen
A synthesized peptide derived from human COX6C(Accession P09669), corresponding to amino acid residues A34-Y53.
Conjugation
Unconjugated
Preparation and Storage
Store at -20 degree C. Stable for 12 months from date of receipt.
WB (Western Blot)
(Western blot analysis of extracts from various samples, using COX6C Mouse Monoclonal Antibody. Lane 1: Raji cells treated with blocking-peptides, Lane 2: Raji cells, Lane 3: mouse kidney tissue, Lane 4: rat liver tissue.)
WB (Western Blot)
(Western blot analysis of extracts from various samples, using COX6C Mouse Monoclonal Antibody. Lane 1: Raji cells treated with blocking-peptides, Lane 2: Raji cells, Lane 3: mouse kidney tissue, Lane 4: rat liver tissue.)
WB (Western Blot)
(Western blot analysis of extracts from various samples, using COX6C Mouse Monoclonal Antibody. Lane 1: 3T3-L1 P6 cells treated with blocking-peptides, Lane 2: 3T3-L1 P6 cells, Lane 3: MCF7 cells.)
WB (Western Blot)
(Western blot analysis of extracts from various samples, using COX6C Mouse Monoclonal Antibody. Lane 1: 3T3-L1 P6 cells treated with blocking-peptides, Lane 2: 3T3-L1 P6 cells, Lane 3: MCF7 cells.)
Related Product Information for anti-COX6C antibody
Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse COX subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene COX6CP1 has been found on chromosomes 16p12.
Product Categories/Family for anti-COX6C antibody
NCBI and Uniprot Product Information
Similar Products
Product Notes
The COX6C (Catalog #AAA330095) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The COX6C Mouse Monoclonal Antibody reacts with Human, Mouse, Rat Prediction: Xenopus and may cross-react with other species as described in the data sheet. AAA Biotech's COX6C can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the COX6C for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAPEVLPKPR MRGLLARRLR NHMAVAFVLS LGVAALYKFR VADQRKKAYA DFYRNYDVMK DFEEMRKAGI FQSVK. It is sometimes possible for the material contained within the vial of "COX6C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.