<
Mouse CSE1L Monoclonal Antibody | anti-CSE1L antibody
CSE1L (CSE1 Chromosome Segregation 1-like (yeast), CAS, CSE1, MGC117283, MGC130036, MGC130037, XPO2) (PE)
Gene Names
CSE1L; CAS; CSE1; XPO2
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
CSE1L, Antibody; CSE1L (CSE1 Chromosome Segregation 1-like (yeast), CAS, CSE1, MGC117283, MGC130036, MGC130037, XPO2) (PE); CSE1 Chromosome Segregation 1-like (yeast); CAS; CSE1; MGC117283; MGC130036; MGC130037; XPO2; anti-CSE1L antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D8
Specificity
Recognizes CSE1L.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CSE1L antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CSE1L (NP_001307, 872aa-971aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Application Data
(Detection limit for recombinant GST tagged CSE1L is approximately 3ng/ml as a capture antibody.)
WB (Western Blot)
(CSE1L monoclonal antibody (M08), clone 3D8 Western Blot analysis of CSE1L expression in Hela S3 NE (Cat # L013V3).)
IF (Immunofluorescence)
(Immunofluorescence of monoclonal antibody to CSE1L on HeLa cell. [antibody concentration 10 ug/ml])
IF (Immunofluorescence)
(Immunofluorescence of monoclonal antibody to CSE1L on HeLa cell. [antibody concentration 10 ug/ml])
IHC (Immunohistochemistry)
(Immunoperoxidase of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml])
Application Data
(Immunoperoxidase of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml])
Related Product Information for anti-CSE1L antibody
Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. [provided by RefSeq]
Product Categories/Family for anti-CSE1L antibody
References
1. CSE1L modulates Ras-induced cancer cell invasion: correlation of K-Ras mutation and CSE1L expression in colorectal cancer progression.Jiang MC, Yeh CM, Tai CJ, Chen HC, Lin SH, Su TC, Shen SC, Lee WR, Liao CF, Li LT, Lee CH, Chen YC, Yeh KT, Chang CCAm J Surg. 2013 Jun 24. pii: S0002-9610(13)00247-X. doi: 10.1016/j.amjsurg.2012.11. 021. 2.MIR-137 Suppresses Growth and Invasion, is Downregulated in Oligodendroglial Tumors and Targets CSE1L.Li KK, Yang L, Pang JC, Chan AK, Zhou L, Mao Y, Wang Y, Lau KM, Poon WS, Shi Z, Ng HK.Brain Pathol. 2012 Dec 17. doi: 10.1111/bpa.12015. 3.The prognostic significance of nuclear CSE1L in urinary bladder urothelial carcinomas.Chang CC, Tai CJ, Su TC, Shen KH, Lin SH, Yeh CM, Yeh KT, Lin YM, Jiang MC.Ann Diagn Pathol. 2012 Apr 2. 4. Differential distributions of CSE1L/CAS and E-cadherin in the polarized and non-polarized epithelial glands of neoplastic colorectal epithelium.Uen WC, Tai CJ, Shen SC, Lee WR, Tsao TY, Deng WP, Chiou HY, Hsu CH, Hsieh CI, Liao CF, Jiang MC.J Mol Histol. 2010 Aug 24. 5. Serum Cellular Apoptosis Susceptibility Protein Is a Potential Prognostic Marker for Metastatic Colorectal Cancer.Stella Tsai CS, Chen HC, Tung JN, Tsou SS, Tsao TY, Liao CF, Chen YC, Yeh CY, Yeh KT, Jiang MC.Am J Pathol. 2010 Apr;176(4):1619-28. Epub 2010 Feb 11. 6. Higher Prevalence of Secretory CSE1L/CAS in Sera of Patients with Metastatic Cancer.Tung MC, Tsai CS, Tung JN, Tsao TY, Chen HC, Yeh KT, Liao CF, Jiang MC.Cancer Epidemiol Biomarkers Prev. 2009 May;18(5):1570-7. Epub 2009 Apr 21. 7.Function of CSE1L/CAS in the secretion of HT-29 human colorectal cells and its expression in human colon. Tsao TY, Tsai CS, Tung JN, Chen SL, Yue CH, Liao CF, Wang CC, Jiang MC.Mol Cell Biochem. 2009 Jul;327(1-2):163-70. Epub 2009 Feb 18.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
103,879 Da
NCBI Official Full Name
exportin-2 isoform 1
NCBI Official Synonym Full Names
CSE1 chromosome segregation 1-like (yeast)
NCBI Official Symbol
CSE1L
NCBI Official Synonym Symbols
CAS; CSE1; XPO2
NCBI Protein Information
exportin-2; cellular apoptosis susceptibility protein; chromosome segregation 1-like protein; exp2; importin-alpha re-exporter
UniProt Protein Name
Exportin-2
UniProt Gene Name
CSE1L
UniProt Synonym Gene Names
CAS; XPO2; Exp2
UniProt Entry Name
XPO2_HUMAN
