Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26556_APP6.jpg Application Data (Detection limit for recombinant GST tagged CSE1L is approximately 0.1ng/ml as a capture antibody.)

Mouse CSE1L Monoclonal Antibody | anti-CSE1L antibody

CSE1L (CSE1 Chromosome Segregation 1-like (yeast), CAS, CSE1, MGC117283, MGC130036, MGC130037, XPO2) (PE)

Gene Names
CSE1L; CAS; CSE1; XPO2
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
CSE1L, Antibody; CSE1L (CSE1 Chromosome Segregation 1-like (yeast), CAS, CSE1, MGC117283, MGC130036, MGC130037, XPO2) (PE); CSE1 Chromosome Segregation 1-like (yeast); CAS; CSE1; MGC117283; MGC130036; MGC130037; XPO2; anti-CSE1L antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3F8
Specificity
Recognizes CSE1L.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CSE1L antibody
IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CSE1L (NP_001307, 872aa-971aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAARVTLL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

(Detection limit for recombinant GST tagged CSE1L is approximately 0.1ng/ml as a capture antibody.)

product-image-AAA26556_APP6.jpg Application Data (Detection limit for recombinant GST tagged CSE1L is approximately 0.1ng/ml as a capture antibody.)

WB (Western Blot)

(CSE1L monoclonal antibody (M05), clone 3F8 Western Blot analysis of CSE1L expression in K-562 (Cat # L009V1).)

product-image-AAA26556_WB5.jpg WB (Western Blot) (CSE1L monoclonal antibody (M05), clone 3F8 Western Blot analysis of CSE1L expression in K-562 (Cat # L009V1).)

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CSE1L on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26556_IF4.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to CSE1L on HeLa cell. [antibody concentration 10 ug/ml])

IF (Immunofluorescence)

(Immunofluorescence of monoclonal antibody to CSE1L on HeLa cell. [antibody concentration 10 ug/ml])

product-image-AAA26556_IF3.jpg IF (Immunofluorescence) (Immunofluorescence of monoclonal antibody to CSE1L on HeLa cell. [antibody concentration 10 ug/ml])

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml])

product-image-AAA26556_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml])

product-image-AAA26556_APP.jpg Application Data (Immunoperoxidase of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml])
Related Product Information for anti-CSE1L antibody
Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. [provided by RefSeq]
Product Categories/Family for anti-CSE1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
103,879 Da
NCBI Official Full Name
exportin-2 isoform 1
NCBI Official Synonym Full Names
CSE1 chromosome segregation 1-like (yeast)
NCBI Official Symbol
CSE1L
NCBI Official Synonym Symbols
CAS; CSE1; XPO2
NCBI Protein Information
exportin-2; cellular apoptosis susceptibility protein; chromosome segregation 1-like protein; exp2; importin-alpha re-exporter
UniProt Protein Name
Exportin-2
UniProt Gene Name
CSE1L
UniProt Synonym Gene Names
CAS; XPO2; Exp2
UniProt Entry Name
XPO2_HUMAN

Similar Products

Product Notes

The CSE1L cse1l (Catalog #AAA26556) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CSE1L can be used in a range of immunoassay formats including, but not limited to, IF (Immunofluorescence), IHC (Immunohistochemistry), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CSE1L cse1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CSE1L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.